Difference between revisions of "Os03g0123300"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 13: Line 13:
  
 
===Expression===
 
===Expression===
 
+
                      [[File:Expression_of_TAD1_during_the_cell-cycle_progression_and_phenotypes_of_TAD1-overexpressing_transgenic_plants.png]]
+
                                  [[File:Expression_of_TAD1_during_the_cell-cycle_progression_and_phenotypes_of_TAD1-overexpressing_transgenic_plants.png]]
 
                           Expression of TAD1 during the cell-cycle progression and phenotypes of ''TAD1''-overexpressing transgenic plants.
 
                           Expression of TAD1 during the cell-cycle progression and phenotypes of ''TAD1''-overexpressing transgenic plants.
  

Revision as of 05:16, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Tillering and Dwarf 1(TAD1), which encodes a co-activator of the anaphase-promoting complex (APC/C), a multi-subunit E3 ligase. The protein interacts with moC1, forms a complex with osAPC10 and functions as a co-activator of APC/C to target MoC1 for degradation in a cell-cycle-dependent manner.

TAD1 encodes a Cdh1-type activator of APC/C, an ortholog to CCS52A in dicots.During the cell-cycl progression, TAD1 shows an oscillating expression pattern with a higher level in the G1-phase.The TAD1-deduced amino-acid sequence contains several conserved domains, including seven WD repeats, C-box, CSM, RVL and IR motifs.

                                                 Deternination of the interaction between TAD1 and MOC1 by coimmunoprecipitation and BiFC assays.png
                                                 Deternination of the interaction between TAD1 and MOC1 by coimmunoprecipitation and BiFC assays.

Sequence analysis revealed that MOC1 harbours a typical D-box at the N-terminal (Fig. 4a). Therefore, it is very likely that MOC1 and TAD1 directly interact to control rice tillering. MOC1–GFP fusion protein could capture the TAD1–FLAG fusion protein, suggesting an in vivo interaction between MOC1 and TAD1 (Fig. 4b). Bimolecular fluorescence complementation shown in Fig. 4c, when the full-length cDNAs of TAD1 and MOC1 were introduced into rice protoplasts simultaneously, the fluorescence signal was detected in the nucleus, indicating that TAD1 can directly interact with MOC1 in the nucleus. Furthermore, when two conserved residues, arginine and leucine, of the D-box at the N-terminal were changed into alanine (Fig. 4a), the MOC1 protein was unable to interact with TAD1, demonstrating that the D-box is indispensable for the interaction between MOC1 and TAD1 (Fig. 4c). In addition, a series of truncated TAD1 proteins were generated to determine the domains that are essential for the interaction with MOC1 viathe BiFC analysis (Fig. 4d). The results showed that the N-terminal 203 amino acids of TAD1 are sufficient to interact with MOC1.

Expression

                                 Expression of TAD1 during the cell-cycle progression and phenotypes of TAD1-overexpressing transgenic plants.png
                          Expression of TAD1 during the cell-cycle progression and phenotypes of TAD1-overexpressing transgenic plants.

TAD1 has an oscillated expression pattern during the cell-cycle progression, showing a higher level in the G1-phase and a lower level in the S- and G2/M-phases. The overexpression of MOC1 resulted in similar phenotypes to that of the tad1mutant plant, such as more tillers and reduced plant height, whereas TAD1-overexpressing transgenic plants showed a reduced tiller number,a similar phenotype to moc1.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0123300

Description

Similar to Cell cycle switch protein

Version

NM_001055339.1 GI:115450406 GeneID:4331448

Length

3573 bp

Definition

Oryza sativa Japonica Group Os03g0123300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:1305797..1309369

Sequence Coding Region

1305822..1306433,1306643..1306765,1306846..1306950,1307352..1307531,1307652..1307714
,1307815..1308009,1308368..1308469,1308549..1308611,1308709..1308777
,1308879..1308938

Expression

GEO Profiles:Os03g0123300

Genome Context

<gbrowseImage1> name=NC_008396:1305797..1309369 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:1305797..1309369 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatcaccaccaccaccacctgccgccgccgccgccgcggtcgccgatggagaactccgcgtcctccaagccgcccaccccggcgtccaccccgtcgtcgcgcctcgccgccgcgccgtcctcccgcgtctcctccgcggcgccgcacccctccccgtcctcctccgcgcccacgccggcctcgcggacggtctacagcgaccgcttcatccccagccgcgccggatccaacctcgcgctcttcgacctcgccccgtcgccgtcccaccacgacgccgccgccgccgccgcctcccccggcgcgccgcccccctccggatctaccccggcctcgtcgccctactgcgcgctcctccgcgccgcgctcttcggccccaccacgcccgaccgggtggcgtcgtcggcgtccgcgtgctcctcctcctcctccgccggggcgtcgcccgtgggctcacccgccaccggcaacatattcaggttcaaggcggaggtgccccggaatgctaagcgcgcccttttctccgacggggacgacgagggcgtgctcttccccggggtgttcacgacgaggggcactggccccaggaagatccctaggtcaccttataaggtgctggatgctcccgcattgcaggatgacttctacctgaaccttgtggattggtcttcgcataatatccttgcagttggattggggaattgtgtctacttatggaatgcatgcagcagcaaggtcaccaagctatgtgatttgggggtggatgacaatgtctgttcagtgggttgggcacagcgtggcactcaccttgctgtagggacaaaccaaggcaaagttcaggtatgggatgccactcgttgtaagagaataagaaccatggaaagccatcggatgcgagtaggtgctcttgcatggaattcatcattgctttcgtcaggcagtcgtgacaagagcatccttcaccatgatatccgtgcccaggatgattatattagtagacttgctgggcataaatcggaggtctgtgggctcaagtggtcttatgataaccgtcagcttgcatctggtggtaatgacaacagactttatgtatggaatcaacactcggcgcacccggtactgaagtatactgagcatacagcagctgtcaaagctattgcgtggtcacctcatcttcatgggctgcttgcatctggtggaggaactgcagatagatgcatacgattttggaataccaccacgaatatgcacttaaattgcgtcgacacaggcagtcaggtctgtaatcttgtatggtcaaagaatgttaatgagcttgttagcactcatggatattctcaaaatcagataattgtttggcgatacccaacaatgtcaaagctcgccacattgacaggccatacatatagggtattatatttagccatctccccagatggacagactatagtaactggcgctggtgatgaaacgcttcggttttggaacgtgtttccatctcccaagtcccagagttctgacagcctaagtagcatcggggccacatcatttgttaggagctacatccggtga</cdnaseq>

Protein Sequence

<aaseq>MDHHHHHLPPPPPRSPMENSASSKPPTPASTPSSRLAAAPSSRV SSAAPHPSPSSSAPTPASRTVYSDRFIPSRAGSNLALFDLAPSPSHHDAAAAAASPGA PPPSGSTPASSPYCALLRAALFGPTTPDRVASSASACSSSSSAGASPVGSPATGNIFR FKAEVPRNAKRALFSDGDDEGVLFPGVFTTRGTGPRKIPRSPYKVLDAPALQDDFYLN LVDWSSHNILAVGLGNCVYLWNACSSKVTKLCDLGVDDNVCSVGWAQRGTHLAVGTNQ GKVQVWDATRCKRIRTMESHRMRVGALAWNSSLLSSGSRDKSILHHDIRAQDDYISRL AGHKSEVCGLKWSYDNRQLASGGNDNRLYVWNQHSAHPVLKYTEHTAAVKAIAWSPHL HGLLASGGGTADRCIRFWNTTTNMHLNCVDTGSQVCNLVWSKNVNELVSTHGYSQNQI IVWRYPTMSKLATLTGHTYRVLYLAISPDGQTIVTGAGDETLRFWNVFPSPKSQSSDS LSSIGATSFVRSYIR</aaseq>

Gene Sequence

<dnaseqindica>26..637#847..969#1050..1154#1556..1735#1856..1918#2019..2213#2572..2673#2753..2815#2913..2981#3083..3142#atccccaaatctctcgcccccacccatggatcaccaccaccaccacctgccgccgccgccgccgcggtcgccgatggagaactccgcgtcctccaagccgcccaccccggcgtccaccccgtcgtcgcgcctcgccgccgcgccgtcctcccgcgtctcctccgcggcgccgcacccctccccgtcctcctccgcgcccacgccggcctcgcggacggtctacagcgaccgcttcatccccagccgcgccggatccaacctcgcgctcttcgacctcgccccgtcgccgtcccaccacgacgccgccgccgccgccgcctcccccggcgcgccgcccccctccggatctaccccggcctcgtcgccctactgcgcgctcctccgcgccgcgctcttcggccccaccacgcccgaccgggtggcgtcgtcggcgtccgcgtgctcctcctcctcctccgccggggcgtcgcccgtgggctcacccgccaccggcaacatattcaggttcaaggcggaggtgccccggaatgctaagcgcgcccttttctccgacggggacgacgagggcgtgctcttccccggggtgttcacgacgaggggcactggccccaggaagatccctaggtcaccttataaggtgagaagtgttcgccttcgatttcatagtttctttcaattgatatggtctgtttcttgattgatgtttctttgaattgagaaaaacatggtctttattattcatctgctctgtaccaagaatcctgtgttatttgtcatgcataaagagactgatatgaaagcttattactcaaaatctcacatgaattttccttctgttgctcttaggtgctggatgctcccgcattgcaggatgacttctacctgaaccttgtggattggtcttcgcataatatccttgcagttggattggggaattgtgtctacttatggaatgcatgcagcagcaaggtgagccaactgcggccatccatgcgcattcttgtttgggtacttgaagagggtttgtaaagaagtttattgctgtgcaggtcaccaagctatgtgatttgggggtggatgacaatgtctgttcagtgggttgggcacagcgtggcactcaccttgctgtagggacaaaccaaggcaaagttcaggttagacgtatgcccctttctgaaatgatcagataacatagtcatgatccaccaaaatttggaacgatgccttagcttaatctttatctagagtgtcaatggaaacattgagaagtatacaactcacttatggaaagatcagaaaaattgcaatactattaacagtggacctaatttttcgcacaaataatatatgatagacgcagtagagttttatgactaaactgaatgactttcatttttactccaaagaatgaatttggtccattgtaatctctgtttacaaatgtgctgtagtatttgatgattatcgattaatcctgttgagctctgaaattggtatgcaatgctacaatttcaatttggtgtctgactgtcaccttggattttatcttatttaggtatgggatgccactcgttgtaagagaataagaaccatggaaagccatcggatgcgagtaggtgctcttgcatggaattcatcattgctttcgtcaggcagtcgtgacaagagcatccttcaccatgatatccgtgcccaggatgattatattagtagacttgctgggcataaatcggaggtgatctattttatacatcattatgaattttccgacatgtcagattcttggattatcctattgtgctcccttttgatatattcttataatatgcatattctgtttccaaacacctttcaggtctgtgggctcaagtggtcttatgataaccgtcagcttgcatctggtggtaatgacaacagagtaagaatgcatccatgaattgtttcttgattggatcattggtattacatggaattcaaggttgcaatttcttatgtccatatcaatgtctcttttccagctttatgtatggaatcaacactcggcgcacccggtactgaagtatactgagcatacagcagctgtcaaagctattgcgtggtcacctcatcttcatgggctgcttgcatctggtggaggaactgcagatagatgcatacgattttggaataccaccacgaatatgcacttaaattgcgtcgacacaggcagtcaggtattttgctacacatctaatttctttagtgattgtgcagcccatgtttatagttctgaactttaatgaactcttgtttattctatttatagtaccatattaaataccgtggtatatggtatgtgaaataagcatgataactctcaatctttggacgcacttaaaaaattgaacatttctttagtcatgtcagttccgaaaagtaagaaatgtaggctgagctctattttcaatagtgaagttctatttcttgttttcatatctgaaaccttcacagaaatgccatgtcattaagactgtagagttaagcatattgttttttggtatgtactgaggacgctgagtgaatcttgaataggtctgtaatcttgtatggtcaaagaatgttaatgagcttgttagcactcatggatattctcaaaatcagataattgtttggcgatacccaacaatgtcaaaggtatgcttgcaagcttattcttaactcagtacgctttacctttttcttgtattaattgtgctcgatttctcctttgtagctcgccacattgacaggccatacatatagggtattatatttagccatctccccagatggacaggtgaagttatctcttgagtctttgaatctactgaattctgtttattgtatctagaatattttggcatagctgtgtttttgacattttatgtcaacagactatagtaactggcgctggtgatgaaacgcttcggttttggaacgtgtttccatctcccaagtcccaggtaccttttttaaaaatagtataattggtccttatttcaatttgaatgaaatttcactttcatatatagcttctaaataataattggtccttcaattacagagttctgacagcctaagtagcatcggggccacatcatttgttaggagctacatccggtgacactgagatgtggtaatctaataacacttggctcataagtcataacactactgcagcagagtgttgatgatcatcaatatcattccatttgtaccacttgcatcaccagttcatgaaccatcaaacctagccaaattttagagatagtaggatgcagaatggtgaaactggctcgcagacctcggagtggctcatttgctgaatgctgtatatatttattcattggctttgtaggagcgaagatggcaaacactgaccatccgcaatgtaccattgataagttcacggcctcctgtttttgtttttgctgagtcaacttggagctggagctcttatgtataccatgctagggcttaacaacattggccaactcatgatgctcattgcatccaagttggaatatgctaaggaagctggagaatttctggtgc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0123300, RefSeq:Os03g0123300