Difference between revisions of "Os04g0690800"
Lixinmei21 (talk | contribs) (→Annotated Information) |
Lixinmei21 (talk | contribs) (→Function) |
||
| Line 6: | Line 6: | ||
PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit. | PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit. | ||
| + | ==Expression== | ||
| + | To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi. | ||
===Evolution=== | ===Evolution=== | ||
| − | Please input evolution information here. | + | Please input evolution information here. |
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
Revision as of 06:55, 8 June 2014
Please input one-sentence summary here.
Contents
Function
PsbS is associated with the reversible de-epoxidation of violaxanthin to zeaxanthin, the so-called xanthophyll cycle.
PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit.
Expression
To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os04g0690800 |
|---|---|
| Description |
22 kDa protein of photosystem II |
| Version |
NM_001060889.1 GI:115461507 GeneID:4337500 |
| Length |
1113 bp |
| Definition |
Oryza sativa Japonica Group Os04g0690800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:35736923..35738035 |
| Sequence Coding Region |
35737068..35737832 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:35736923..35738035 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:35736923..35738035 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatga</cdnaseq> |
| Protein Sequence |
<aaseq>MALQQSMAMPMMVVSDLGTAPRSSPMVQLQRMKKHLVVVAAFKS RTKASPKVDKSNKNKSIVEDGIFGTSGGIGFTKENELFVGRVAMLGFAASLLGEAVTG KGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDDATGLERAVIPPG KGFRAALGLSEGGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGV PINEIEPLLLFNILFFFFAAINPGTGKFVTDDNDDQ</aaseq> |
| Gene Sequence |
<dnaseqindica>146..910#attccaagagagcaagccaagatcaagagatcgatcatatcgtattttgtagtaatttagcagctagctagtgcagctgcaagctattagcgactgcatgctttgatcgatccatctagctaattgttgaatccatctaagcttaatggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatgagcccagcccacccctcattttgcttttactccacttaattaaattagcttcttctgatagtagtaaggagacggttaagtggactagctagtcaatgtcaatcctctcctctgtactgtagtggagtagtatctacttatatgcatatactagcaaaaattcaggacacaacaatcaatcggtactcctgaatgcatgatggg</dnaseqindica> |
| External Link(s) |