Difference between revisions of "Os04g0690800"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Function)
Line 6: Line 6:
  
 
PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit.
 
PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit.
 +
==Expression==
 +
To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
Please input evolution information here.  
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 06:55, 8 June 2014

Please input one-sentence summary here.

Function

PsbS is associated with the reversible de-epoxidation of violaxanthin to zeaxanthin, the so-called xanthophyll cycle.

PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit.

Expression

To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0690800

Description

22 kDa protein of photosystem II

Version

NM_001060889.1 GI:115461507 GeneID:4337500

Length

1113 bp

Definition

Oryza sativa Japonica Group Os04g0690800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:35736923..35738035

Sequence Coding Region

35737068..35737832

Expression

GEO Profiles:Os04g0690800

Genome Context

<gbrowseImage1> name=NC_008397:35736923..35738035 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:35736923..35738035 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatga</cdnaseq>

Protein Sequence

<aaseq>MALQQSMAMPMMVVSDLGTAPRSSPMVQLQRMKKHLVVVAAFKS RTKASPKVDKSNKNKSIVEDGIFGTSGGIGFTKENELFVGRVAMLGFAASLLGEAVTG KGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDDATGLERAVIPPG KGFRAALGLSEGGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGV PINEIEPLLLFNILFFFFAAINPGTGKFVTDDNDDQ</aaseq>

Gene Sequence

<dnaseqindica>146..910#attccaagagagcaagccaagatcaagagatcgatcatatcgtattttgtagtaatttagcagctagctagtgcagctgcaagctattagcgactgcatgctttgatcgatccatctagctaattgttgaatccatctaagcttaatggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatgagcccagcccacccctcattttgcttttactccacttaattaaattagcttcttctgatagtagtaaggagacggttaagtggactagctagtcaatgtcaatcctctcctctgtactgtagtggagtagtatctacttatatgcatatactagcaaaaattcaggacacaacaatcaatcggtactcctgaatgcatgatggg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0690800, RefSeq:Os04g0690800