Difference between revisions of "Os04g0494100"
(→Function) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | OsChia4a, which was identified to be one of the highest JA-inductive genes. The recombinant protein of His-tagged OsChia4a exhibited an inhibitory effect against the spore germination and hyphal growth of Magnaporthe oryzae. The promoter analysis of OsChia4a revealed that the region from −515 bp to −265 bp upstream of the ATG translation initiation site was required for the responsiveness to JA. A subsequent mutation analysis indicated that an E-box (CANNTG) in this region act as a JA-responsive cis element. These results imply that a basic helix-loop-helix transcription factor is likely to be involved in the regulation of the OsChia4a expression in a JA-dependent manner. | |
| + | |||
| + | Family 19 chitinases in Oryza sativa L. cv. Nipponbare: one class I (OsChia1d), two class II (OsChia2a and OsChia2b), and one class IV (OsChia4a). OsChia2a resembled (about 60z identity) the catalytic domains of class I chitinases, but OsChia2b was almost identical (95z identity) to that of the class IV enzyme. The class IV catalytic domains have three deletions (Fig. 1) that correspond to the loops between a- helices C and D, F and G, and G and H. | ||
| + | |||
| + | OsChia2b and the catalytic domain of OsChia4a were very similar (95z identity) and resembled (60–70z identity) the class IV chitinases of other plants rather than the class I enzymes (o60 identity). In addition, three deletions and a cysteine residue located at the carboxyl terminal are features of class IV chitinases。 | ||
===Expression=== | ===Expression=== | ||
Revision as of 07:28, 8 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsChia4a, which was identified to be one of the highest JA-inductive genes. The recombinant protein of His-tagged OsChia4a exhibited an inhibitory effect against the spore germination and hyphal growth of Magnaporthe oryzae. The promoter analysis of OsChia4a revealed that the region from −515 bp to −265 bp upstream of the ATG translation initiation site was required for the responsiveness to JA. A subsequent mutation analysis indicated that an E-box (CANNTG) in this region act as a JA-responsive cis element. These results imply that a basic helix-loop-helix transcription factor is likely to be involved in the regulation of the OsChia4a expression in a JA-dependent manner.
Family 19 chitinases in Oryza sativa L. cv. Nipponbare: one class I (OsChia1d), two class II (OsChia2a and OsChia2b), and one class IV (OsChia4a). OsChia2a resembled (about 60z identity) the catalytic domains of class I chitinases, but OsChia2b was almost identical (95z identity) to that of the class IV enzyme. The class IV catalytic domains have three deletions (Fig. 1) that correspond to the loops between a- helices C and D, F and G, and G and H.
OsChia2b and the catalytic domain of OsChia4a were very similar (95z identity) and resembled (60–70z identity) the class IV chitinases of other plants rather than the class I enzymes (o60 identity). In addition, three deletions and a cysteine residue located at the carboxyl terminal are features of class IV chitinases。
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os04g0494100 |
|---|---|
| Description |
Similar to Chitinase |
| Version |
NM_001059721.1 GI:115459171 GeneID:4336265 |
| Length |
1169 bp |
| Definition |
Oryza sativa Japonica Group Os04g0494100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:25107288..25108456 |
| Sequence Coding Region |
25107468..25107874,25107963..25108422 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:25107288..25108456 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:25107288..25108456 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgaactcaccgacgccgacaatgctggcgttcctggctcttgggctagcgctcctcctctccgccaccggccaggcgagcgcgcagaactgcggctgccagtcgaacatgtgctgcagcaaatgggggtactgcggcacgggcaaggactactgcggagatgggtgccgctctggcccgtgctacggcggcggcggcggtggaggaggaggaggcggaggtggtggaggcggaggcggaggcagcggcgtgtctgtagagagcgtggtcaccgaggcgttcttcaatgggatcaagaaccaggccccgaacggttgcgccggcaagaacttttacacacgacagtcgtttcttaacgctgcccactcctactcgggcttcgccagggaccgcaccaacgatgactccaagcgtgagatcgctgccttctttgcccacgtcactcatgagaccggacatatgtgctacatcaacgagataaacggggcgagcatggactactgcgacaagaacaacaagcagtggccgtgccagccggggaagaagtactacgggcgcgggccgctgcagatctcgtggaactacaactacgggcctgcggggcagaacatcgggttcgacgggctgagggacccggacagggtggcgcaggacccgacgatctccttcaagacggcgctctggttctggatgaacaacgtgcaccaggtgatgttgcaggggttcggcgccaccatccgggccatcaacggtgcgctcgagtgcaacggcaagaaccccggcgccgtcaacgcaagggtaaactactacaaagactactgccgccaattcggcgttgacccgggtggcaacctttactgttga</cdnaseq> |
| Protein Sequence |
<aaseq>MANSPTPTMLAFLALGLALLLSATGQASAQNCGCQSNMCCSKWG YCGTGKDYCGDGCRSGPCYGGGGGGGGGGGGGGGGGGGSGVSVESVVTEAFFNGIKNQ APNGCAGKNFYTRQSFLNAAHSYSGFARDRTNDDSKREIAAFFAHVTHETGHMCYINE INGASMDYCDKNNKQWPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDGLRDPDRVAQ DPTISFKTALWFWMNNVHQVMLQGFGATIRAINGALECNGKNPGAVNARVNYYKDYCR QFGVDPGGNLYC</aaseq> |
| Gene Sequence |
<dnaseqindica>583..989#35..494#atcaaccatcacctctttcacaccatatcctataatggcgaactcaccgacgccgacaatgctggcgttcctggctcttgggctagcgctcctcctctccgccaccggccaggcgagcgcgcagaactgcggctgccagtcgaacatgtgctgcagcaaatgggggtactgcggcacgggcaaggactactgcggagatgggtgccgctctggcccgtgctacggcggcggcggcggtggaggaggaggaggcggaggtggtggaggcggaggcggaggcagcggcgtgtctgtagagagcgtggtcaccgaggcgttcttcaatgggatcaagaaccaggccccgaacggttgcgccggcaagaacttttacacacgacagtcgtttcttaacgctgcccactcctactcgggcttcgccagggaccgcaccaacgatgactccaagcgtgagatcgctgccttctttgcccacgtcactcatgagaccggacgtaaggaaaatatttaattacatactcctggtatttgtacatatatgcatgtaactaatgaggatgataaatgataatgcactcgcagatatgtgctacatcaacgagataaacggggcgagcatggactactgcgacaagaacaacaagcagtggccgtgccagccggggaagaagtactacgggcgcgggccgctgcagatctcgtggaactacaactacgggcctgcggggcagaacatcgggttcgacgggctgagggacccggacagggtggcgcaggacccgacgatctccttcaagacggcgctctggttctggatgaacaacgtgcaccaggtgatgttgcaggggttcggcgccaccatccgggccatcaacggtgcgctcgagtgcaacggcaagaaccccggcgccgtcaacgcaagggtaaactactacaaagactactgccgccaattcggcgttgacccgggtggcaacctttactgttgagttacatgcacacatgctgcgcggctcatcgatcaggactgaataataaacaaagtaataacgaataaaacgtttggtgtgtacgtacattgcatgcacgtacggtacatgttgcaagtgacgtcaagagtttggtacggataaatatgaaaaataaaatgttgggatcaggattaaatg</dnaseqindica> |
| External Link(s) |