Difference between revisions of "Os04g0494100"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
OsChia4a, which was identified to be one of the highest JA-inductive genes. The recombinant protein of His-tagged OsChia4a exhibited an inhibitory effect against the spore germination and hyphal growth of Magnaporthe oryzae. The promoter analysis of OsChia4a revealed that the region from −515 bp to −265 bp upstream of the ATG translation initiation site was required for the responsiveness to JA. A subsequent mutation analysis indicated that an E-box (CANNTG) in this region act as a JA-responsive cis element. These results imply that a basic helix-loop-helix transcription factor is likely to be involved in the regulation of the OsChia4a expression in a JA-dependent manner.[[File:Wiki OsChia4a location.png|thumb|说明文字]]
+
OsChia4a, which was identified to be one of the highest JA-inductive genes. The recombinant protein of His-tagged OsChia4a exhibited an inhibitory effect against the spore germination and hyphal growth of Magnaporthe oryzae. The promoter analysis of OsChia4a revealed that the region from −515 bp to −265 bp upstream of the ATG translation initiation site was required for the responsiveness to JA. A subsequent mutation analysis indicated that an E-box (CANNTG) in this region act as a JA-responsive cis element. These results imply that a basic helix-loop-helix transcription factor is likely to be involved in the regulation of the OsChia4a expression in a JA-dependent manner.
 
Family 19 chitinases in Oryza sativa L. cv. Nipponbare: one class I (OsChia1d), two class II (OsChia2a and OsChia2b), and one class IV (OsChia4a). OsChia2a resembled (about 60z identity) the catalytic domains of class I chitinases, but OsChia2b was almost identical (95z identity) to that of the class IV enzyme. The class IV catalytic domains have three deletions (Fig. 1) that correspond to the loops between a- helices C and D, F and G, and G and H.
 
Family 19 chitinases in Oryza sativa L. cv. Nipponbare: one class I (OsChia1d), two class II (OsChia2a and OsChia2b), and one class IV (OsChia4a). OsChia2a resembled (about 60z identity) the catalytic domains of class I chitinases, but OsChia2b was almost identical (95z identity) to that of the class IV enzyme. The class IV catalytic domains have three deletions (Fig. 1) that correspond to the loops between a- helices C and D, F and G, and G and H.
  

Revision as of 07:37, 8 June 2014

Please input one-sentence summary here.

GeneOs04g0494100 ,namelyOsChia4a,is a class IV chitinase that has similarity (about 70z identity) to both maize ChiA and Arabidopsis ChIV of class IV chitinases

Annotated Information

Function

OsChia4a, which was identified to be one of the highest JA-inductive genes. The recombinant protein of His-tagged OsChia4a exhibited an inhibitory effect against the spore germination and hyphal growth of Magnaporthe oryzae. The promoter analysis of OsChia4a revealed that the region from −515 bp to −265 bp upstream of the ATG translation initiation site was required for the responsiveness to JA. A subsequent mutation analysis indicated that an E-box (CANNTG) in this region act as a JA-responsive cis element. These results imply that a basic helix-loop-helix transcription factor is likely to be involved in the regulation of the OsChia4a expression in a JA-dependent manner. Family 19 chitinases in Oryza sativa L. cv. Nipponbare: one class I (OsChia1d), two class II (OsChia2a and OsChia2b), and one class IV (OsChia4a). OsChia2a resembled (about 60z identity) the catalytic domains of class I chitinases, but OsChia2b was almost identical (95z identity) to that of the class IV enzyme. The class IV catalytic domains have three deletions (Fig. 1) that correspond to the loops between a- helices C and D, F and G, and G and H.

OsChia2b and the catalytic domain of OsChia4a were very similar (95z identity) and resembled (60–70z identity) the class IV chitinases of other plants rather than the class I enzymes (o60 identity). In addition, three deletions and a cysteine residue located at the carboxyl terminal are features of class IV chitinases。

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0494100

Description

Similar to Chitinase

Version

NM_001059721.1 GI:115459171 GeneID:4336265

Length

1169 bp

Definition

Oryza sativa Japonica Group Os04g0494100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:25107288..25108456

Sequence Coding Region

25107468..25107874,25107963..25108422

Expression

GEO Profiles:Os04g0494100

Genome Context

<gbrowseImage1> name=NC_008397:25107288..25108456 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:25107288..25108456 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgaactcaccgacgccgacaatgctggcgttcctggctcttgggctagcgctcctcctctccgccaccggccaggcgagcgcgcagaactgcggctgccagtcgaacatgtgctgcagcaaatgggggtactgcggcacgggcaaggactactgcggagatgggtgccgctctggcccgtgctacggcggcggcggcggtggaggaggaggaggcggaggtggtggaggcggaggcggaggcagcggcgtgtctgtagagagcgtggtcaccgaggcgttcttcaatgggatcaagaaccaggccccgaacggttgcgccggcaagaacttttacacacgacagtcgtttcttaacgctgcccactcctactcgggcttcgccagggaccgcaccaacgatgactccaagcgtgagatcgctgccttctttgcccacgtcactcatgagaccggacatatgtgctacatcaacgagataaacggggcgagcatggactactgcgacaagaacaacaagcagtggccgtgccagccggggaagaagtactacgggcgcgggccgctgcagatctcgtggaactacaactacgggcctgcggggcagaacatcgggttcgacgggctgagggacccggacagggtggcgcaggacccgacgatctccttcaagacggcgctctggttctggatgaacaacgtgcaccaggtgatgttgcaggggttcggcgccaccatccgggccatcaacggtgcgctcgagtgcaacggcaagaaccccggcgccgtcaacgcaagggtaaactactacaaagactactgccgccaattcggcgttgacccgggtggcaacctttactgttga</cdnaseq>

Protein Sequence

<aaseq>MANSPTPTMLAFLALGLALLLSATGQASAQNCGCQSNMCCSKWG YCGTGKDYCGDGCRSGPCYGGGGGGGGGGGGGGGGGGGSGVSVESVVTEAFFNGIKNQ APNGCAGKNFYTRQSFLNAAHSYSGFARDRTNDDSKREIAAFFAHVTHETGHMCYINE INGASMDYCDKNNKQWPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDGLRDPDRVAQ DPTISFKTALWFWMNNVHQVMLQGFGATIRAINGALECNGKNPGAVNARVNYYKDYCR QFGVDPGGNLYC</aaseq>

Gene Sequence

<dnaseqindica>583..989#35..494#atcaaccatcacctctttcacaccatatcctataatggcgaactcaccgacgccgacaatgctggcgttcctggctcttgggctagcgctcctcctctccgccaccggccaggcgagcgcgcagaactgcggctgccagtcgaacatgtgctgcagcaaatgggggtactgcggcacgggcaaggactactgcggagatgggtgccgctctggcccgtgctacggcggcggcggcggtggaggaggaggaggcggaggtggtggaggcggaggcggaggcagcggcgtgtctgtagagagcgtggtcaccgaggcgttcttcaatgggatcaagaaccaggccccgaacggttgcgccggcaagaacttttacacacgacagtcgtttcttaacgctgcccactcctactcgggcttcgccagggaccgcaccaacgatgactccaagcgtgagatcgctgccttctttgcccacgtcactcatgagaccggacgtaaggaaaatatttaattacatactcctggtatttgtacatatatgcatgtaactaatgaggatgataaatgataatgcactcgcagatatgtgctacatcaacgagataaacggggcgagcatggactactgcgacaagaacaacaagcagtggccgtgccagccggggaagaagtactacgggcgcgggccgctgcagatctcgtggaactacaactacgggcctgcggggcagaacatcgggttcgacgggctgagggacccggacagggtggcgcaggacccgacgatctccttcaagacggcgctctggttctggatgaacaacgtgcaccaggtgatgttgcaggggttcggcgccaccatccgggccatcaacggtgcgctcgagtgcaacggcaagaaccccggcgccgtcaacgcaagggtaaactactacaaagactactgccgccaattcggcgttgacccgggtggcaacctttactgttgagttacatgcacacatgctgcgcggctcatcgatcaggactgaataataaacaaagtaataacgaataaaacgtttggtgtgtacgtacattgcatgcacgtacggtacatgttgcaagtgacgtcaagagtttggtacggataaatatgaaaaataaaatgttgggatcaggattaaatg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0494100, RefSeq:Os04g0494100