Difference between revisions of "Os04g0690800"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 20: Line 20:
  
 
==References==
 
==References==
Satoshi Ishida1,4, Ken-ichi Morita1,4, Masahiro Kishine1, Atsushi Takabayashi1, Reiko Murakami1,Satomi Takeda2, Ko Shimamoto3, FumihikoSat1and Tsuyoshi Endo1,*(2011)Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice.''Cell Physiol (2011) 52 (10): 1822-1831''
+
Satoshi Ishida1,4, Ken-ichi Morita1,4, Masahiro Kishine1, Atsushi Takabayashi1, Reiko Murakami1,Satomi Takeda2, Ko Shimamoto3, FumihikoSat1  and Tsuyoshi Endo1.Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:54, 8 June 2014

Please input one-sentence summary here.

Function

PsbS is associated with the reversible de-epoxidation of violaxanthin to zeaxanthin, the so-called xanthophyll cycle.

PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit.

Expression

To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi.File:Expression of psbS genes in transgenic plants.png

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

There are many labs working on PsbS.Demmig-Adams and Hendrickson both have their own models on this study. EST, expressed sequence tag; Fm(Fm0), themaximum fluorescence achieved with a saturating light pulse in the dark (or in the light);Fo (Fo0), the minimumfluorescence achieved under the measuring light in the dark(or in the light); Fs, steady-state fluorescence in the light; �D,the quantum rate of absorbed light energy in PSII allocated to Dissipationin the Demmig-Adams model; �E , the quantum rate of absorbed light energy in PSII allocated to Exess in the Demmig-Adams model; �f,D, the quantum yield of basic dissipation in the Hendrickson model;�NPQ, the quantum yield of light-inducible dissipation in the Hendrickson model.

References

Satoshi Ishida1,4, Ken-ichi Morita1,4, Masahiro Kishine1, Atsushi Takabayashi1, Reiko Murakami1,Satomi Takeda2, Ko Shimamoto3, FumihikoSat1 and Tsuyoshi Endo1.Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.

Structured Information

Gene Name

Os04g0690800

Description

22 kDa protein of photosystem II

Version

NM_001060889.1 GI:115461507 GeneID:4337500

Length

1113 bp

Definition

Oryza sativa Japonica Group Os04g0690800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:35736923..35738035

Sequence Coding Region

35737068..35737832

Expression

GEO Profiles:Os04g0690800

Genome Context

<gbrowseImage1> name=NC_008397:35736923..35738035 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:35736923..35738035 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatga</cdnaseq>

Protein Sequence

<aaseq>MALQQSMAMPMMVVSDLGTAPRSSPMVQLQRMKKHLVVVAAFKS RTKASPKVDKSNKNKSIVEDGIFGTSGGIGFTKENELFVGRVAMLGFAASLLGEAVTG KGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDDATGLERAVIPPG KGFRAALGLSEGGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGV PINEIEPLLLFNILFFFFAAINPGTGKFVTDDNDDQ</aaseq>

Gene Sequence

<dnaseqindica>146..910#attccaagagagcaagccaagatcaagagatcgatcatatcgtattttgtagtaatttagcagctagctagtgcagctgcaagctattagcgactgcatgctttgatcgatccatctagctaattgttgaatccatctaagcttaatggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatgagcccagcccacccctcattttgcttttactccacttaattaaattagcttcttctgatagtagtaaggagacggttaagtggactagctagtcaatgtcaatcctctcctctgtactgtagtggagtagtatctacttatatgcatatactagcaaaaattcaggacacaacaatcaatcggtactcctgaatgcatgatggg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0690800, RefSeq:Os04g0690800