Difference between revisions of "Os08g0535200"

From RiceWiki
Jump to: navigation, search
(Expression)
(Knowledge relation)
Line 17: Line 17:
  
 
===Evolution===
 
===Evolution===
1.The discovery of xa13 and its resistance to bacterial blight of rice,then mapping it, Identificating Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India.
+
The type Ⅲ secretion system (T3SS) effector is considered as one of the key virulence factors
2.The researches of mechanism of action and Characterization,Now TAL effect specific combination model and TAL effect child repetitive structure domain by choice are known,there are two proteins:Os-8N3 and Os-11N3 ,they are coding close relatives,and the functions are studied.
+
in Xanthomonas oryzae. X. oryzae pv. oryzae and X. oryzae pv. oryzicola cause bacterial leaf blight and bacterial leaf streak in rice, which are important bacterial diseases of rice.
3.However ,how to put the promoting effect of pathogen infection child as targets by host is unknown
+
Based on bioinformatic analysis of the bacterial genome and other recent reports, X. oryzae contains at least 28 classes of T3SS effectors, divided into two groups: TAL (transcription activator-like) effectors and non-TAL (non transcription activator-like) effectors.
4.XA13 participated in the redistribution of the copper.
+
TAL effectors are secreted through the TTSS and targeted to host nuclei, a process that is mediated by the conserved N-terminal and C-terminal regions, respectively.TAL effectors combined with a specific gene promoter DNA, similar to eukaryotic transcription factor gene expression in plants start to control the physiological and biochemical processes of plants.
 
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 08:37, 8 June 2014

Xa13 are Rice recessive resistance genes controlling of rice disease resistance and the reproductive growth .

Annotated Information

Function

The xa13 gene is fully recessive, conferring resistance only in the homozygous status.This gene specifically confers resistance to the Philippine Xoo race 6(PXO99).It interacts strongly with other R genes such as xa5, Xa4 and Xa21. After its fine mapping we found two candidate genes, a prime stretch class is rich in protein gene homologous gene proline, and the other is the nodule gene MtN3 homologous gene. The dominant allele,Xa13, is required for both bacterial growth and pollen development. Promoter mutations in Xa13 cause down regulation of expression during host–pathogen interaction,resulting in the fully recessive xa13 that confers race-specific resistance. Xa13 encodes an indispensable plasma membrane protein of the MtN3/saliva family, which is prevalent in eukaryotes with unknown biochemical function.XA13 protein cooperates with two other proteins, COPT1 and COPT5, to promote removal of copper from xylem vessels, where Xoo multiplies and spreads to cause disease. Chen also found XA13 belongs SWEET family can transport from extracellular glucose within the cell , thus providing nutrients for the bacteria , beneficial bacteria growth and reproduction .

Localization

Xa13 is Located in the long arm of rice the chromosome 8.

Expression

xa13 expression levels in leaves is very low, but the high level of expression in the ear and anther. RNA interference by inhibiting the expression of xa13, enhanced xa13-mediated resistance, indicating that the absence of a dominant allele xa13 bacterial blight resistance is a must.

Evolution

The type Ⅲ secretion system (T3SS) effector is considered as one of the key virulence factors in Xanthomonas oryzae. X. oryzae pv. oryzae and X. oryzae pv. oryzicola cause bacterial leaf blight and bacterial leaf streak in rice, which are important bacterial diseases of rice. Based on bioinformatic analysis of the bacterial genome and other recent reports, X. oryzae contains at least 28 classes of T3SS effectors, divided into two groups: TAL (transcription activator-like) effectors and non-TAL (non transcription activator-like) effectors. TAL effectors are secreted through the TTSS and targeted to host nuclei, a process that is mediated by the conserved N-terminal and C-terminal regions, respectively.TAL effectors combined with a specific gene promoter DNA, similar to eukaryotic transcription factor gene expression in plants start to control the physiological and biochemical processes of plants.

Labs working on this gene

National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research (Wuhan), Huazhong Agricultural University. Plant Pathology, Kansas State University. Genetics, Development, and Cell Biology, Iowa State University

References

1. Changyan Li;Jing Wei;Yongjun Lin;Hao Chen

 Gene silencing using the recessive rice bacterial blight resistance gene xa13 as a new paradigm in plant breeding
 Plant Cell Reports, 2012, 31(5): 851-862

2. Ting Yuan;Xianghua Li;Jinghua Xiao;Shiping Wang

 Characterization of Xanthomonas oryzae-Responsive cis-Acting Element in the Promoter of Rice Race-Specific Susceptibility Gene Xa13
 Molecular Plant, 2011, 4(2): 300-309

3. Ginny Antony;Junhui Zhou;Sheng Huang;Ting Lib;Bo Liu;Frank White;Bing Yang

 Rice xa13 Recessive Resistance to Bacterial Blight Is Defeated by Induction of the Disease Susceptibility Gene Os-11N3
 The Plant Cell, 2010, 22(11): 3864-3876

4. Meng Yuan;Zhaohui Chu;Xianghua Li;Caiguo Xu;Shiping Wang

 The Bacterial Pathogen Xanthomonas oryzae Overcomes Rice Defenses by Regulating Host Copper Redistribution
 The Plant Cell, 2010, 22(9): 3164-3176

5. Zhaohui Chu;Meng Yuan;Jialing Yao;Xiaojia Ge;Bin Yuan;Caiguo Xu;Xianghua Li;Binying Fu;Zhikang Li;Jeffrey L. Bennetzen;Qifa Zhang and Shiping Wang

 Promoter mutations of an essential gene for pollen development result in disease resistance in rice
 GENES & DEVELOPMENT, 2006, 20(10): 1250-1255

6. Zhaohui Chu;Binying Fu;Hong Yang;Caiguo Xu;Zhikang Li;A. Sanchez;Y. J. Park;J. L. Bennetzen;Qifa Zhang and Shiping Wang

 Targeting xa13, a recessive gene for bacterial blight resistance in rice
 Theoretical and Applied Genetics, 2006, 112(3): 455-461

7. Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar

 Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India
 Phytopathology, 2001, 85(5): 506-512

8. A. C. Sanchez;L. L. Ilag;D. Yang;D. S. Brar;F. Ausubel;G. S. Khush;M. Yano;T. Sasaki;Z. Li;N. Huang

 Genetic and physical mapping of xa13, a recessive bacterial blight resistance gene in rice
 Theoretical and Applied Genetics, 1999, 98(6-7): 1022-1028

9. G. Zhang;E. R. Angeles;M. L. P. Abenes;G. S. Khush and N. Huang

 RAPD and RFLP mapping of the bacterial blight resistance gene xa-13 in rice
 Theoretical and Applied Genetics, 1996, 93(1-2): 65-70

10. T. OGAWA, Luo LIN, R. E. TABIEN and G. S. KHUSH

 A new recessive gene for resistance to bacterial blight of rice
 Rice Genetics Newsletters, 1987, 4(0): 98-100

Structured Information

Gene Name

Os08g0535200

Description

Similar to MtN3-like protein

Version

NM_001068889.1 GI:115477516 GeneID:4346153

Length

2843 bp

Definition

Oryza sativa Japonica Group Os08g0535200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:26813957..26816799

Sequence Coding Region

26814378..26814713,26814806..26814925,26815020..26815392,26815491..26815527,26816571..26816628

Expression

GEO Profiles:Os08g0535200

Genome Context

<gbrowseImage1> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggaaacatcatctccttcctggtgttccttgcaccagtggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatgtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtga</cdnaseq>

Protein Sequence

<aaseq>MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKST GGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRAR LRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVI KTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRK PRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAA EQAADGVAAAAAADKELLQNKPEVIEITAAV</aaseq>

Gene Sequence

<dnaseqindica>2087..2422#1875..1994#1408..1780#1273..1309#172..229#acacatgcagttgtagtagcacttaagccttcctctctagctagcatctcttgtgtcaggaagttggaagggatttctggctagtttctagctggtgtctcctctcctcttcctaaccttctcactgattaacaccttagagttagttaataaccttcatcaccagtagcaatggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggtaaagcatgcaaccaatgcataatgctcaaacttaatttcatcatcatcatcatcatcatcatcttcacagccatgatcatccatggacaaatgcaactgaagatcattttagttttcatatgctaatgatcaaattcaggttaattgctgtttaatttctccatacactagttgttgtctgcaccattgcattgtgcacagcacacacacgcttttgatgcttctaggaatgcatatctgttcagcagttcacacagtgcagcagggcaatgttgttaaaaaatcttctccttttttttatgtccttgtgttcttgagctttctgtctccattgatctgcttttttcttgtttacaagtgatgggcacaagtcacttccctagcttcagctcatgcatggagcaggaatctcacttcaaaagacctagcactttttctctcttcacctttttgcctcaacacatgcccagtttctggccacacaaacataaacacatatactatctagctgcataattgcatcaaattaagcagggtttgtttcagctaggaattccacacataggtcattaattagtattgccaactttctcaacatgcatgcactctagtactctacctaagctagctcccagattagcttctgctaatttaattccgatttcttgaaatggagatcggttgagcagtgagggaggcgtgcatctgctcctcttcgtcgctgtcactaaacaaaagcagagctagctaggtggtaacaaactgatttgatttttgtcagtaaacaaaaatgaccaattaatgacccatcaaccagtttcaattctcgatcctaacctagctaacatctctgaaactctgaaagaacattactatcttactgacagtgtatatatatgcaaactaaaattttattttattttatcctaacctagctaacatatctgcatccgtgtgaaccagctgaaactctgaaagaatgttactccactgatcatatattaattaacgatgtcgttttctgtcttgtttcttttgcaggaaacatcatctccttcctggtgttccttgcaccagtgtgagtactccattcctactgtcaccatcaaaatctcgagagaaacatctgaatatctctgacgacgaactggaatttatatctctgaaaaattgcagggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcgtaagcttaagctctctaccccccctctacatttcactgacatcaattgcattatgtagctgagcatttctgttgatgatgatgatgcttgcagttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatggtgagctcagctgccgccattgatagagctgctcgacgacgccattgttgtgaattgttttgagctgacttgcatttcttggtgcgatgcagtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtgacgacgactgatctcgacgacgacagattctcgctactgatgaagaagacgacgacgatggccggatcgatgacggacagaatttagcagtgtggattactaccgaactttaattagttggttaattattggattacaatgtggtaagagtgtgtcattagcagctagttaacttacttaaattaattatcttgttcagtcagtcagtcagtcagtcagtcagtcagctttgagtgagtgagtgagtgatctcgacgtagtttgctggttggtgtaataagaaaaaggcgatctactagtagtctactagctagtacgcatgcatgtgtgtgtgctctacttaccgtgttgcaatctcatctctttgtacttacaactcagaaatcaatggaagattgtgacaggtattattagtagttact</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0535200, RefSeq:Os08g0535200