Difference between revisions of "Os05g0392300"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Cyclin-dependent protein kinases (CDKs) play key roles in regulating the eukaryotic cell cycle. Cyclin-dependent kinases (CDKs) are the central components of eukaryotic cell cycle regulation. Cell division is regulated by the sequential activation of cyclin-dependent kinases (CDKs). CDKs are among the most highly regulated enzymes known. In animals and yeast, two classes of CAKs have been identified. They are represented by human p40 MO15/Cdk7 and by Cak1p Civ1 from budding yeast. These CAKs have low homology with each other, and they differ in their enzyme characteristics. Human Cdk7 has been shown to phosphorylate CDK substrates and the C-terminal domain (CTD) of the large subunit of RNA polymerase II, the second reaction as part of the general transcription factor IIH. Because transcription factor IIH also is involved in nucleotide excision repair, Cdk7 may have functions in cell cycle control, in transcriptional regulation, and in DNA repair. Budding yeast Cak1p acts as a CAK but does not display CTD kinase activity.
+
    Cyclin-dependent protein kinases (CDKs) play key roles in regulating the eukaryotic cell cycle. Cyclin-dependent kinases (CDKs) are the central components of eukaryotic cell cycle regulation. Cell division is regulated by the sequential activation of cyclin-dependent kinases (CDKs). CDKs are among the most highly regulated enzymes known. In animals and yeast, two classes of CAKs have been identified. They are represented by human p40 MO15/Cdk7 and by Cak1p Civ1 from budding yeast. These CAKs have low homology with each other, and they differ in their enzyme characteristics. Human Cdk7 has been shown to phosphorylate CDK substrates and the C-terminal domain (CTD) of the large subunit of RNA polymerase II, the second reaction as part of the general transcription factor IIH. Because transcription factor IIH also is involved in nucleotide excision repair, Cdk7 may have functions in cell cycle control, in transcriptional regulation, and in DNA repair. Budding yeast Cak1p acts as a CAK but does not display CTD kinase activity.
 +
    Most CDKs are thought to be activated by CAKs, and CAKs are essential genes. Animal and yeast CAKs are expressed and active throughout the mitotic cell cycle with no change in subcellular localization, indicating that CAKs are not regulated in these organisms. CAK overexpression increased CAK activity but did not produce a mutant phenotype. Yet, CDK phosphorylation appearsto have specific functions in cell cycle regulation. Immunodepletion of Xenopus XlCdk7 in egg extracts suppressed CAK activity and arrested cells before M-phase. Furthermore, Drosophila DmCdk7 was shown toactivate mitotic CDK complexes and was required for mitosis. Also, the fission yeast Cdk7 homolog Mcs6/Crk1/Mop1 was isolated in a screen as a potential mitotic inducer resulting from increased Cdc2 activity. Analysis of a Cak1p mutant from budding yeast showed that 70% of all cells arrested at G1/S and that the remaining cells arrested in G2/M, indicating that this CAK clearly was required for both G1/S and G2/M transitions.
  
 
===Expression===
 
===Expression===

Revision as of 13:10, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

   Cyclin-dependent protein kinases (CDKs) play key roles in regulating the eukaryotic cell cycle. Cyclin-dependent kinases (CDKs) are the central components of eukaryotic cell cycle regulation. Cell division is regulated by the sequential activation of cyclin-dependent kinases (CDKs). CDKs are among the most highly regulated enzymes known. In animals and yeast, two classes of CAKs have been identified. They are represented by human p40 MO15/Cdk7 and by Cak1p Civ1 from budding yeast. These CAKs have low homology with each other, and they differ in their enzyme characteristics. Human Cdk7 has been shown to phosphorylate CDK substrates and the C-terminal domain (CTD) of the large subunit of RNA polymerase II, the second reaction as part of the general transcription factor IIH. Because transcription factor IIH also is involved in nucleotide excision repair, Cdk7 may have functions in cell cycle control, in transcriptional regulation, and in DNA repair. Budding yeast Cak1p acts as a CAK but does not display CTD kinase activity.
   Most CDKs are thought to be activated by CAKs, and CAKs are essential genes. Animal and yeast CAKs are expressed and active throughout the mitotic cell cycle with no change in subcellular localization, indicating that CAKs are not regulated in these organisms. CAK overexpression increased CAK activity but did not produce a mutant phenotype. Yet, CDK phosphorylation appearsto have specific functions in cell cycle regulation. Immunodepletion of Xenopus XlCdk7 in egg extracts suppressed CAK activity and arrested cells before M-phase. Furthermore, Drosophila DmCdk7 was shown toactivate mitotic CDK complexes and was required for mitosis. Also, the fission yeast Cdk7 homolog Mcs6/Crk1/Mop1 was isolated in a screen as a potential mitotic inducer resulting from increased Cdc2 activity. Analysis of a Cak1p mutant from budding yeast showed that 70% of all cells arrested at G1/S and that the remaining cells arrested in G2/M, indicating that this CAK clearly was required for both G1/S and G2/M transitions.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0392300

Description

CDC2+/CDC28-related protein kinase R2 (EC 2.7.1.-)

Version

NM_001061985.1 GI:115463700 GeneID:4338689

Length

5710 bp

Definition

Oryza sativa Japonica Group Os05g0392300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:19090752..19096461

Sequence Coding Region

19090927..19091046,19091772..19092070,19092136..19092244,19092932..19093057,19095273..19095508
,19095601..19095921,19096081..19096144

Expression

GEO Profiles:Os05g0392300

Genome Context

<gbrowseImage1> name=NC_008398:19090752..19096461 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:19090752..19096461 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgagcggcgacggcggcgacgacgcgggcgtgaagcgcgtggcggaccgctacctgaagcgcgaggtcctgggagagggaacctacggcgtcgtcttcaaggccgtcgacaccaagactgggaatacagtcgcaataaagaaaatccggctagggaagtacaaggaaggtgtcaatttcactgcattgagggaaattaaacttcttaaggagctgaaagattctaatattatagagctgattgatgctttcccttacaagggaaacttacatcttgtatttgagttcatggagactgatttggaagctgtcatacgagataggaacattgtattatctccagctgatacaaaatcttatattcagatgatgttaaaaggtttagccttctgccataagaaatgggtgctacacagggatatgaaaccaaataatttactcattggcgctgatgggcagcttaagcttgctgactttggtctggcgcgcatatttgggagtccagagcggaacttcactcatcaggtctttgcacgatggtaccgagcaccagaattattatttggcaccaagcagtatggatctgcagttgatatttgggctgctggttgtatttttgctgaactgctgcttaggcgaccgtttctccagggttctagtgacattgatcaacttgggaagatctttgctgcatttggaactccaaagtcttctcaatggccggacatggtttatcttccagattatgttgaataccaatttgtctctgcacctccacttcgctcattgtttccaatggccagtgatgatgcattggatcttctatcaagaatgtttacatatgatccaaaagcaagaattacagctcagcaggctctagaacaccggtactttttatcagtaccagcgccaacaaaaccatcacagcttccaaggccaccacctaagggtgattcagggaataacaagataccagacttgaacctgcaggacggccctgttgttctgtccccgccaagaaagttgcgcagggtgactgcccatgaagggatggaagtccatatgcatcgggcggatagaacagaagagcatccttcaggggcaaggcacatggatgacatgtccagccagagttctagaataccaatgtcagttgatgttggagctatttttgggacacgacctgctcctagaccaacgttaaacagtgccgacaagtctcgtttaaaacggaaacttgatatggatccagaatttggatacacagagtaa</cdnaseq>

Protein Sequence

<aaseq>MASGDGGDDAGVKRVADRYLKREVLGEGTYGVVFKAVDTKTGNT VAIKKIRLGKYKEGVNFTALREIKLLKELKDSNIIELIDAFPYKGNLHLVFEFMETDL EAVIRDRNIVLSPADTKSYIQMMLKGLAFCHKKWVLHRDMKPNNLLIGADGQLKLADF GLARIFGSPERNFTHQVFARWYRAPELLFGTKQYGSAVDIWAAGCIFAELLLRRPFLQ GSSDIDQLGKIFAAFGTPKSSQWPDMVYLPDYVEYQFVSAPPLRSLFPMASDDALDLL SRMFTYDPKARITAQQALEHRYFLSVPAPTKPSQLPRPPPKGDSGNNKIPDLNLQDGP VVLSPPRKLRRVTAHEGMEVHMHRADRTEEHPSGARHMDDMSSQSSRIPMSVDVGAIF GTRPAPRPTLNSADKSRLKRKLDMDPEFGYTE</aaseq>

Gene Sequence

<dnaseqindica>176..295#1021..1319#1385..1493#2181..2306#4522..4757#4850..5170#5330..5393#cgcgcatcgcagccgagacgagccgccccccgcaccgcactctccgccgccggcgccgcgccgacctcctccgccgcgccgcctccccggcgcgcgcccccgtcaccctctctcgcctcgccgccgccgccgctgcctcctcgtgaggggggacggtggtgggggcctctgccctatggcgagcggcgacggcggcgacgacgcgggcgtgaagcgcgtggcggaccgctacctgaagcgcgaggtcctgggagagggaacctacggcgtcgtcttcaaggccgtcgacaccaaggtccatctcatcccatcccatcaccccccccccccccccacttctcccgctcctaaaaccctcaccggtgcacatcgtcgcgcgcgccggggggcgcgctgatctgccgccgcctcgagaaatttagtcgccggccggctagttcgggccctccggctcgatccgaccgcccggtggagaggcgggtggtcgggtgatttgagcttcaagggttttgttcccggattgtgaaattgcgtcagtgaacggatggctagagctgttctttctgcaggggcagtctaggttggccacccatgagccgtggttgagcccatgaatgcaattcacctggttttgttcactgccgtgtggattgaactggaggtgttgacactgtgagggtgtttgagctgtggttattgttttgccatctcttcttaagcaaatcgcagtttatccactctgatgggaggggatctgtgggatagcagggtttgttgtgtcgtggactcatgtatctttgtattatgataggctatatggtgccagcctttcactctacagattttgggtgtgctcctagtgcttttaagttttaagtttattacatcagctgtttggaatgtattgtcgtggaattttgcttcttgcttttgttaacttttattgatatcatgaatgttcttcactttgtttgagttaatgttagggttattgaacttttacatgttccttgttttcagactgggaatacagtcgcaataaagaaaatccggctagggaagtacaaggaaggtgtcaatttcactgcattgagggaaattaaacttcttaaggagctgaaagattctaatattatagagctgattgatgctttcccttacaagggaaacttacatcttgtatttgagttcatggagactgatttggaagctgtcatacgagataggaacattgtattatctccagctgatacaaaatcttatattcagatgatgttaaaaggtttagccttctgccataagaaatgggtgctacacaggtatccactaataatcttgctaaatttcttttagagagagtatcctttgacaatctgtgctgtagggatatgaaaccaaataatttactcattggcgctgatgggcagcttaagcttgctgactttggtctggcgcgcatatttgggagtccagagcggaacttcactcatcaggttcttttttgtggaattatatttattagaatttaattctctgtataatctagtcgattgtatacttggaacttgagaatcttgttgctgaaacaaatatgcaatgaacatttcttcaagtgtattgatgtttcttttgtatttttttaactcggtcgatattgctgtttgatgcttcgttgttctgtttatcaaaaagaacatccttgtggatattttgcgcccttatgctttacccttttttcaacaacagtaggcacctaggaagtagaaaagcttaaatctttatggatggaacaaaatgcatgtggggaagttcttatgttatttcctggacatttgagttggcagagttggattttgaataaatgtcacaggatactgatttcggaagtatgtgtccttgaataaccattttcttggtaaatattaatagtgttggaatgactgtttcattctgaattatttgtgctgattttcattcaccatcatatctggaggttctcttaaaccatctttttatcagttatgttgacgatagtcaaggatcaatgctacacttattacagcaatgctgtgtgctttgcttaaatgagtgttttttattttttattagtttcactttgaatcatattatcctgatgctgctgggcacttcagttttgaattttttttctcaacatataggtctttgcacgatggtaccgagcaccagaattattatttggcaccaagcagtatggatctgcagttgatatttgggctgctggttgtatttttgctgaactgctgcttaggcgaccgtttctccaggtttaaccgactcttataattttatgctctgtgtaatttcaatctatttataactaagcactttttatgctctgagaatgttgcatggctaagtttgctgttcctatatgttgtgataactgcatgcgtaaatgtgttacctcaaaatgttgtttccaaagccagattggacttgtagttttcaactgaggaaactggaaatggtcaggctctggtgaggtgattgaactgaacctgtaaatgatttaaactttgggtttaaatttgacaaagtgtttcaatggtaacagtaaaaaaattcctctgtggatttgaacctttgtctgtagattctggaatagaagaagctagttcctctgtgcatgtagttgatattagatttatttaatgagcacgttataatagtctagcactggtaggttcacgcaaattaagcctcgctctagttttagacttcaatataacaaaattatgtatgttatgtggggctgcatgtgcagccgcctgtgcatgacagttgccatgctcttcacaaccaacacaccaactatgttggctcctccacaagtttagtagctagatcatttccactgctagtttgtttgtttccgtaggattaaattatttaagggcttgcctgagaatatgatgcaagctgaaagttgtcccacgatctctctcctaacgccatggtgttgggcgacaaggtgtcacgcccttgtcctcttgccatccatcagcacaggtattatctgactgactcccaagaatcccctgaaccatgtgacaatgtacaccttcacaataatgttatttagagaaccagttagatcagtgaacagacgagtcatagtattggctgggtcgatgcctgcaaacgaccagttttcatgcttgaggtcattgtttactatatgtgaaatctgccattagttgtttacgagtagttttgggtaaggaagctacccctagaaatctgtgcatggggagaaaagggttggactttctagattcactagggtattgtttgtttctttccttttctatgttttttggaaggtagattttgtggcatgtgctcttaggccttactttcaagtgatagatctgattattctcttcaaaactattttaggtagaaaaatgttattcctttctccagtcttatgggatataggcacttgttactaagttcacgggtttgtgcttgattttaagcttattgcctgagatttggttaccctggctacttgttctggccatacatattttggccaaagaagggttttcaggttatcacaactataatgttctgattactggtggggttcttttagcattgaaaattaaaactgcaattccttgttattgttttacttgaattttttgaacatggtgtttttttttttggattagacgcacggagaaaacattaatgcacatgggaggctagataacatgaataaaatatggacttgtggtcttgtgctaaatgtgcataattctttttcactcaactgaaagccttcttaggccagttgtagaggtttaatttgttgcttctggtcttgctgcaggtcctcttgagtttcctgattttttatcttgtgtattctccagaaatgtggaatcatggagttgaatattcttgtgttgatttattttttattggttttttttattataaatttgttttctttatctatacttacaagtcaagttcttagatgcagtagaggtgttaattccattttaaggaattttagatgctcatctaaatttttcatcatgtatgaaaggcttttcatgtcactatccgtggttttctttgtgagaggcagcaattggttgaaaatattttgatctatatctaactatggttctctatttgattttcaatagacaagttgtttgctttctaggatcagatctgtctgcagctctaagtaaatgctctactgtcacaacttcttcatttcttacaaatcaagtgatttgtaaactttgggtttataacctcttaagagagcattgctgcatatgtattttgtaagcgttgtttcatcagtatgcctgatctttttgcatgtgtgctgataagagaaggttggaaaatgtgatatgatatttaacagtgggcagcaattttttcatttggtagctataccttaaaagctttaatgggcacccaagtcactaaatgttaatgttgcagggttctagtgacattgatcaacttgggaagatctttgctgcatttggaactccaaagtcttctcaatggccggacatggtttatcttccagattatgttgaataccaatttgtctctgcacctccacttcgctcattgtttccaatggccagtgatgatgcattggatcttctatcaagaatgtttacatatgatccaaaagcaagaattacagctcagcaggctctagaacaccggtatgcctttgttactgatcaatagaacatctgctatctatctctgttattagtacatgccatataaaaccatgtttatctttcctattaaggtactttttatcagtaccagcgccaacaaaaccatcacagcttccaaggccaccacctaagggtgattcagggaataacaagataccagacttgaacctgcaggacggccctgttgttctgtccccgccaagaaagttgcgcagggtgactgcccatgaagggatggaagtccatatgcatcgggcggatagaacagaagagcatccttcaggggcaaggcacatggatgacatgtccagccagagttctagaataccaatgtcagttgatgttggagctatttttgggacacgacctgctcctagaccaacgttaaacaggtaaacgacacaaaccttgacgaatggaaatttggaactcatgtccttgtctaaatgaccaatgaacctaataatggaataaatgatgcatttaggattgggtgtgctcagctcgcccattctgtggaataattgaacatatttatttccattttgcagtgccgacaagtctcgtttaaaacggaaacttgatatggatccagaatttggatacacagagtaaatcaccattttttccatactggcttgttgatttttaaaatattctttggggagatagttccactatctaccaacaaaagaggattgtgtcgaaagccataaaaacttcactgaagggcgctgacaggatggcacagccaactatgctgttatcgtttttgactaccaaagccggctcaggaagaggaaactgaagagttacgtgttacgatgctaatttacaccaggacgtgcacatgccatttcattttggctggcatacataaatctgtaatctttattgcatagatgagtttgcttgtgtgagcatgtttcttc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0392300, RefSeq:Os05g0392300