Difference between revisions of "Os06g0600400"

From RiceWiki
Jump to: navigation, search
(References)
m (References)
Line 28: Line 28:
 
1. Tomoaki Sakamoto;Ayami Kawabe;Asako Tokida-Segawa;Bun-ichi Shimizu;Suguru Takatsuto;Yukihisa Shimada;Shozo Fujioka;Masaharu Mizutani Rice CYP734As function as multisubstrate and multifunctional enzymes in brassinosteroid catabolism. The Plant Journal, 2011, 67(1): 1-12
 
1. Tomoaki Sakamoto;Ayami Kawabe;Asako Tokida-Segawa;Bun-ichi Shimizu;Suguru Takatsuto;Yukihisa Shimada;Shozo Fujioka;Masaharu Mizutani Rice CYP734As function as multisubstrate and multifunctional enzymes in brassinosteroid catabolism. The Plant Journal, 2011, 67(1): 1-12
 
2,Bak, S., Paque tte, S., Morant, M. et al. (2006) Cyanogenic glycosides: a case study for evolution and application of cytochromes P450. Phytochem. Rev.5, 309–329.
 
2,Bak, S., Paque tte, S., Morant, M. et al. (2006) Cyanogenic glycosides: a case study for evolution and application of cytochromes P450. Phytochem. Rev.5, 309–329.
 +
3,Bak, S., Paquette, S., Morant, M. et al. (2006) Cyanogenic glycosides: a case study for evolution and application of cytochromes P450. Phytochem. Rev.5, 309–329.
 +
Bishop, G.J. (2007) Refining the plant steroid hormone biosynthesis pathway.Trends Plant Sci. 12, 377–380.
 +
4,Clouse, S.D. and Sasse, J.M. (1998) Brassinosteroids: essential regulators of plant growth and development. Annu. Rev. Plant Physiol. Plant Mol. Biol.49, 427–451.
 +
5,Clouse, S.D., Langford, M. and McMorris, T.C. (1996) A brassinosteroid-insensitive mutant in Arabidopsis thaliana exhibits multiple defects in growth and development. Plant Physiol. 111, 671–678.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 14:28, 8 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Rice CYP734As are multifunctional, multisubstrate enzymes that control the endogenous bioactive brassinosteroid content both by direct inactivation of CS and by the suppression of CS biosynthesis by decreasing the levels of brassinosteroid precursors.In addition, rice CYP734As can catalyze hydroxylation and the second and third oxidations to produce aldehyde and carboxylate groups at C-26 in vitro.Two P450s,CYP734A1/BAS1 and CYP72C1/SOB7/CHI2/SHK1, also act in the inactivation of brassinosteroids by means of different enzymatic activities.

Expression

Please input expression information here.

Expression of CYP 734A genes in wild-type and mutant rice.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1,overexpression of CYP734A genes in transgenic rice. 2,isolation of CYP734A1/BAS1-like genes from rice. 3,catalytic activities of rice CYP734As. 4,determination off the position oxidized by CYP734A2. 5,substrate specificity of CYP734A2.

References

Please input cited references here. 1. Tomoaki Sakamoto;Ayami Kawabe;Asako Tokida-Segawa;Bun-ichi Shimizu;Suguru Takatsuto;Yukihisa Shimada;Shozo Fujioka;Masaharu Mizutani Rice CYP734As function as multisubstrate and multifunctional enzymes in brassinosteroid catabolism. The Plant Journal, 2011, 67(1): 1-12 2,Bak, S., Paque tte, S., Morant, M. et al. (2006) Cyanogenic glycosides: a case study for evolution and application of cytochromes P450. Phytochem. Rev.5, 309–329. 3,Bak, S., Paquette, S., Morant, M. et al. (2006) Cyanogenic glycosides: a case study for evolution and application of cytochromes P450. Phytochem. Rev.5, 309–329. Bishop, G.J. (2007) Refining the plant steroid hormone biosynthesis pathway.Trends Plant Sci. 12, 377–380. 4,Clouse, S.D. and Sasse, J.M. (1998) Brassinosteroids: essential regulators of plant growth and development. Annu. Rev. Plant Physiol. Plant Mol. Biol.49, 427–451. 5,Clouse, S.D., Langford, M. and McMorris, T.C. (1996) A brassinosteroid-insensitive mutant in Arabidopsis thaliana exhibits multiple defects in growth and development. Plant Physiol. 111, 671–678.

Structured Information

Gene Name

Os06g0600400

Description

Cytochrome P450 family protein

Version

NM_001064535.1 GI:115468801 GeneID:4341450

Length

2534 bp

Definition

Oryza sativa Japonica Group Os06g0600400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:24581718..24584251

Sequence Coding Region

24581820..24582093,24582172..24582395,24582502..24582749,24582848..24583250,24583353..24583820

Expression

GEO Profiles:Os06g0600400

Genome Context

<gbrowseImage1> name=NC_008399:24581718..24584251 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:24581718..24584251 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatggaggcggtggccgtggcggcggcggtgctgctgctgctgcacgtggcggcgagggtggcggacgcggtgtggtggcggccgaggcggctggaggcgcacttcgcggggcagggggtgcgcggcccgccgtaccggttcctcgtcgggtgcgtgagggagatggtggcgctcatggcggaggccaccgcgaagcccatgccgcccgccgcgccgcacaacgcgctccccagggtgctcgcgttctaccactactggaggaagatctacgggccgacgttcttgatttggttcgggccgacaccgcggctcacggtggcggagccggagatggtgcgggagatcttcctcacgcgcgccgaggcgttcgaccgctacgaggcgcaccccgtggtccggcagctggagggcgacgggctcgtcagcctccacggcgacaagtgggctcaccaccgccgcgtcctcacccccggcttctaccccgacaacctcaaccggctggtgccgcacgtcggcaggtcggtggcggcgctggcggagaggtggcgcgccatggcgtgcgccggcggcggcgaggtggaggtggacgtggcggagtggttccaggcggtggcggaggaggccatcacgcgcgccacgttcggccgcagctacgactccggccgcgtcgtgttccgcttgcaggcccgcctcatggcgttcgcctccgaggccttccgcaaggtgctcgtcccgggatacaggttcctgccgaccaagaagaacaggatgtcgtggggcctggacagggagatcaggcgcggcctggtccggctcatcggccggcgcagtggcggcgacggcggcgaggaagacgagaccaccaccgagctcaaagacaagcaggacagcggcttcaacgacttgctggggctcatgatcaatgccggcgtggacaggacgatgccggtggaggacatggtggaggagtgcaagaccttcttcttcgccggcaagcagacgaccaccaacctgctcacctgggccaccgtgctgctcgccatgcacccggactggcaggaccgcgcccgccgcgaggtcctcgccgtctgcggcgatgccgccggcgagctccccaccaaggaccacctccccaagctcaagacgctcgggatgatcctcaacgagacgctgcgcctgtacccgccggcggtggccaccatccgccgcgccaagttcgacgtcaccctcggcggcggtggcgacggcgacgccggaggcatccatatcccgcgcgacacggagctgctcgtcccgatcatggcgatccaccacgacgcccggttgtgggggcccgacgcggcccagttcaacccggcgaggttcgccagcggcgcggcgcgcgcggcgaagcacccgctcgccttcatcccgttcgggctgggctcccgcatgtgcatcggccagagcctcgccatcctcgaggccaagctcaccatggccgtcctcctccagcgcttcgacctcgcgctctcgcccacctacgtgcacgcccccaccgtgctgatgctgctccacccgcagtacggcgcgccgttgatcttccggccgcgccaatctcagccgtccaattag</cdnaseq>

Protein Sequence

<aaseq>MMEAVAVAAAVLLLLHVAARVADAVWWRPRRLEAHFAGQGVRGP PYRFLVGCVREMVALMAEATAKPMPPAAPHNALPRVLAFYHYWRKIYGPTFLIWFGPT PRLTVAEPEMVREIFLTRAEAFDRYEAHPVVRQLEGDGLVSLHGDKWAHHRRVLTPGF YPDNLNRLVPHVGRSVAALAERWRAMACAGGGEVEVDVAEWFQAVAEEAITRATFGRS YDSGRVVFRLQARLMAFASEAFRKVLVPGYRFLPTKKNRMSWGLDREIRRGLVRLIGR RSGGDGGEEDETTTELKDKQDSGFNDLLGLMINAGVDRTMPVEDMVEECKTFFFAGKQ TTTNLLTWATVLLAMHPDWQDRARREVLAVCGDAAGELPTKDHLPKLKTLGMILNETL RLYPPAVATIRRAKFDVTLGGGGDGDAGGIHIPRDTELLVPIMAIHHDARLWGPDAAQ FNPARFASGAARAAKHPLAFIPFGLGSRMCIGQSLAILEAKLTMAVLLQRFDLALSPT YVHAPTVLMLLHPQYGAPLIFRPRQSQPSN</aaseq>

Gene Sequence

<dnaseqindica>103..376#455..678#785..1032#1131..1533#1636..2103#aaacccccaacccaaccgccgccaccactcaccggcgcaaccaccggcggcgacctgatctctctgcgtttgtgtgctctgtttcaagaaacaggggaggagatgatggaggcggtggccgtggcggcggcggtgctgctgctgctgcacgtggcggcgagggtggcggacgcggtgtggtggcggccgaggcggctggaggcgcacttcgcggggcagggggtgcgcggcccgccgtaccggttcctcgtcgggtgcgtgagggagatggtggcgctcatggcggaggccaccgcgaagcccatgccgcccgccgcgccgcacaacgcgctccccagggtgctcgcgttctaccactactggaggaagatctacggtatgttgaggacggatggattttgtgtgcttgctcgtgtctgatcagatggattaatggcggtcgtcgcggttgcagggccgacgttcttgatttggttcgggccgacaccgcggctcacggtggcggagccggagatggtgcgggagatcttcctcacgcgcgccgaggcgttcgaccgctacgaggcgcaccccgtggtccggcagctggagggcgacgggctcgtcagcctccacggcgacaagtgggctcaccaccgccgcgtcctcacccccggcttctaccccgacaacctcaacgtgagtctctcctctgtttcttcatcctccgatcgatcggggcgcacccgcgatgacgacgacgacgatggctgacacgtgctctgtctctgtctctctcttgcagcggctggtgccgcacgtcggcaggtcggtggcggcgctggcggagaggtggcgcgccatggcgtgcgccggcggcggcgaggtggaggtggacgtggcggagtggttccaggcggtggcggaggaggccatcacgcgcgccacgttcggccgcagctacgactccggccgcgtcgtgttccgcttgcaggcccgcctcatggcgttcgcctccgaggccttccgcaaggtgctcgtcccgggatacaggtacggtacacgccacgaacaacccaaaaaactcccaaacgattcgccattctcgccgaaattgggctcacggttggcgccggaattcgatcgaacaggttcctgccgaccaagaagaacaggatgtcgtggggcctggacagggagatcaggcgcggcctggtccggctcatcggccggcgcagtggcggcgacggcggcgaggaagacgagaccaccaccgagctcaaagacaagcaggacagcggcttcaacgacttgctggggctcatgatcaatgccggcgtggacaggacgatgccggtggaggacatggtggaggagtgcaagaccttcttcttcgccggcaagcagacgaccaccaacctgctcacctgggccaccgtgctgctcgccatgcacccggactggcaggaccgcgcccgccgcgaggtcctcgccgtctgcggcgatgccgccggcgagctccccaccaaggaccacctccccaagctcaagacggtacgcacaccaaaccatatccatggcccagtgggggtattcccgtaattccacgccgacaaaagtctcaccttgttggttctcgctgtcatcttcttccagctcgggatgatcctcaacgagacgctgcgcctgtacccgccggcggtggccaccatccgccgcgccaagttcgacgtcaccctcggcggcggtggcgacggcgacgccggaggcatccatatcccgcgcgacacggagctgctcgtcccgatcatggcgatccaccacgacgcccggttgtgggggcccgacgcggcccagttcaacccggcgaggttcgccagcggcgcggcgcgcgcggcgaagcacccgctcgccttcatcccgttcgggctgggctcccgcatgtgcatcggccagagcctcgccatcctcgaggccaagctcaccatggccgtcctcctccagcgcttcgacctcgcgctctcgcccacctacgtgcacgcccccaccgtgctgatgctgctccacccgcagtacggcgcgccgttgatcttccggccgcgccaatctcagccgtccaattagctactattactaggtaggagtactagtattgctagctaggaaaagacaggaaagcccctgtccgttgtgtgcatagtgacacaggaaaaggccaagagacaactaacaaaaggctctgcccgtggcaggggcagggccggattccgaaaatgccctcgctaacagactagtggtacgatcagagcacaacttttagggatttgatgggtcagaaactctcagaagagaagaagagagacagtagtagggtagtagcagtagccccacacatccactgctcggttgcttccatttgttctcttctccttcgcgtggattctggtgtatgtatcgatcaatgcatgtacctgtatgtgtgtgttgtgtacaggggtgtgattattttgattcgggacacccggcacttcacagcaaaggagaattccatttgg</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0600400, RefSeq:Os06g0600400