Difference between revisions of "Os08g0237000"
(→Evolution) |
(→Evolution) |
||
| Line 14: | Line 14: | ||
===Evolution=== | ===Evolution=== | ||
| − | The analysis revealed that XTHs could be loosely grouped into four distinct groups. Group 1 contains genes that share a high level of sequence identity among different species and that are expressed in young developing tissues. Group 2 comprises XTH genes from several species showing diverse patterns of expression and response to hormonal or mechanical stimuli, including touchinducible, flooding-response, BR-inducible, and fruit ripening-related XTHs. Group 3 represents a divergent group of XTHs, including NXG1 from nasturtium (''Tropaeolum'' ''majus'') that can act as xyloglucan hydrolase and transglycosylase. OsXTH8 has the highest homology to sequences in Group 4, consisting of well-characterized barley (''Hordeum vulgare'') genes, HvPM2 and HvPM5,which are up-regulated by GA in barley leaf sheaths and leaves. Monocot members of group 4 revealed to have two substitutions (DEIDIEFMG) compared to the consensus sequence (DEIDFEFLG). The presence of different amino acid residues in the putative catalytic region may attribute to unique enzymatic activity of OsXTH8. | + | The analysis revealed that XTHs could be loosely grouped into four distinct groups (Fig. 3). Group 1 contains genes that share a high level of sequence identity among different species and that are expressed in young developing tissues. Group 2 comprises ''XTH'' genes from several species showing diverse patterns of expression and response to hormonal or mechanical stimuli, including touchinducible, flooding-response, BR-inducible, and fruit ripening-related ''XTHs''. Group 3 represents a divergent group of ''XTHs'', including ''NXG1'' from nasturtium (''Tropaeolum'' ''majus'') that can act as xyloglucan hydrolase and transglycosylase. OsXTH8 has the highest homology to sequences in Group 4, consisting of well-characterized barley (''Hordeum vulgare'') genes, ''HvPM2'' and ''HvPM5'',which are up-regulated by GA in barley leaf sheaths and leaves. Monocot members of group 4 revealed to have two substitutions (DEIDIEFMG) compared to the consensus sequence (DEIDFEFLG). The presence of different amino acid residues in the putative catalytic region may attribute to unique enzymatic activity of OsXTH8. |
[[File:rice 2.jpg|caption]] | [[File:rice 2.jpg|caption]] | ||
Revision as of 02:00, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Xyloglucan endotransglucosylases/hydrolases (XTHs) that mediate cleavage and rejoining of the β (1-4)-xyloglucans of the primary cell wall are considered to play an important role in the construction and restructuring of xyloglucan cross-links.OsXTH8 was a single copy gene; its full-length cDNA was 1,298 bp encoding a predicted protein of 290 amino acids.OsXTH8 may play cooperative role with OsXTR1, OsXTR2, OsXTR3, OsXTR4 genes and others that are expressed in overlapping regions. OsXTH8 is involved in cell wall modification processes during rice growth and development.OsXTH8 acts to alter the structure of cell wall in response to gibberellic acid.
Expression
OsXTH8 was preferentially expressed in rice leaf sheath in response to gibberellic acid. OsXTH8 was highly expressed in vascular bundles of leaf sheath and young nodal roots where the cells are actively undergoing elongation and differentiation. OsXTH8 gene expression was up-regulated by gibberellic acid and there was very little effect of other hormones. Reduced accumulation of active GA was accompanied by preferential suppression of OsXTH8 expression, and OsXTH8 expression increased when exogenous GA3 was applied to the semidwarf mutant. In two genetic mutants of rice with abnormal height, the expression of OsXTH8 positively correlated with the height of the mutants. Transgenic rice expressing an RNAi construct of OsXTH8 exhibited repressed growth. These results indicate that OsXTH8 is differentially expressed in rice leaf sheath in relation to gibberellin and potentially involved in cell elongation processes.
OsXTH8 was expressed in growing regions such as shoot apical meristem, vascular bundles of leaf sheath, and young crown roots developing from nodes; thus, OsXTH8 exhibited a unique expression pattern in terms of organ and stage specificity during leaf sheath elongation and young nodal root development. The expression of OsXTH8 in the shoot apex meristem, vascular bundles in leaf sheath, and youngnodal roots supports its role in cell wall modification processes during active growth.
Evolution
The analysis revealed that XTHs could be loosely grouped into four distinct groups (Fig. 3). Group 1 contains genes that share a high level of sequence identity among different species and that are expressed in young developing tissues. Group 2 comprises XTH genes from several species showing diverse patterns of expression and response to hormonal or mechanical stimuli, including touchinducible, flooding-response, BR-inducible, and fruit ripening-related XTHs. Group 3 represents a divergent group of XTHs, including NXG1 from nasturtium (Tropaeolum majus) that can act as xyloglucan hydrolase and transglycosylase. OsXTH8 has the highest homology to sequences in Group 4, consisting of well-characterized barley (Hordeum vulgare) genes, HvPM2 and HvPM5,which are up-regulated by GA in barley leaf sheaths and leaves. Monocot members of group 4 revealed to have two substitutions (DEIDIEFMG) compared to the consensus sequence (DEIDFEFLG). The presence of different amino acid residues in the putative catalytic region may attribute to unique enzymatic activity of OsXTH8.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os08g0237000 |
|---|---|
| Description |
Xyloglucan endotransglycosylase/hydrolase protein 8 precursor (EC 2.4.1.207) (End-xyloglucan transferase) (OsXTH8) (OsXRT5) |
| Version |
NM_001067854.1 GI:115475444 GeneID:4345019 |
| Length |
1378 bp |
| Definition |
Oryza sativa Japonica Group Os08g0237000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:8327025..8328402 |
| Sequence Coding Region |
8327064..8327545,8327644..8328034 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:8327025..8328402 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:8327025..8328402 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgaagcatctcgcgctgtccgtggccgccgcggtggccgtgtcgtggctggcggcgtcgtcggcggcggcggcggggttctacgagaagttcgacgtggtgggcgccggcgaccacgtgagggtggtgagcgacgacgggaagacgcagcaggtggcgctgacgctggaccggagctccgggtccgggttcacctccaaggacacctacctgttcggcgagttcagcgtccagatgaagctcgtcggcggcaactccgccggcaccgtcacctccttctacctctcctccggcgagggcgacggccacgacgagatcgacatcgagttcatgggcaacctcagcggcaacccctacgtcatgaacaccaacgtctgggctaatggcgacggcaagaaggagcaccagttctacctctggttcgaccccaccgccgacttccacacctacaagatcatctggaatccccaaaacatcatattccaggtggacgacgtgccggtgaggacgttcaagaagtacgacgacctggcgtacccgcagagcaagccgatgaggctgcacgcgacgctgtgggacggcagctactgggcgacgaggcacggcgacgtcaagatcgactggagcggcgcgccgttcgtggtgtcgtaccgcgggtacagcaccaacgcgtgcgtcaacaacaatcccgccggcgggtggtcgtcgtcgtggtgccccgagggcacgtcggcgtggatccaccgcgagctcgacggcgccgagctcggcaccgtcgcgtgggccgagcgcaactacatgtcctacaactactgcgccgacggctggcgcttcccccagggcttccccgccgagtgctaccgcaagtga</cdnaseq> |
| Protein Sequence |
<aaseq>MAKHLALSVAAAVAVSWLAASSAAAAGFYEKFDVVGAGDHVRVV SDDGKTQQVALTLDRSSGSGFTSKDTYLFGEFSVQMKLVGGNSAGTVTSFYLSSGEGD GHDEIDIEFMGNLSGNPYVMNTNVWANGDGKKEHQFYLWFDPTADFHTYKIIWNPQNI IFQVDDVPVRTFKKYDDLAYPQSKPMRLHATLWDGSYWATRHGDVKIDWSGAPFVVSY RGYSTNACVNNNPAGGWSSSWCPEGTSAWIHRELDGAELGTVAWAERNYMSYNYCADG WRFPQGFPAECYRK</aaseq> |
| Gene Sequence |
<dnaseqindica>40..521#620..1010#atccaccacccaaagacaaagcaagcaagtacagtagccatggcgaagcatctcgcgctgtccgtggccgccgcggtggccgtgtcgtggctggcggcgtcgtcggcggcggcggcggggttctacgagaagttcgacgtggtgggcgccggcgaccacgtgagggtggtgagcgacgacgggaagacgcagcaggtggcgctgacgctggaccggagctccgggtccgggttcacctccaaggacacctacctgttcggcgagttcagcgtccagatgaagctcgtcggcggcaactccgccggcaccgtcacctccttctacctctcctccggcgagggcgacggccacgacgagatcgacatcgagttcatgggcaacctcagcggcaacccctacgtcatgaacaccaacgtctgggctaatggcgacggcaagaaggagcaccagttctacctctggttcgaccccaccgccgacttccacacctacaagatcatctggaatccccaaaacatcatgtacgcatcacaaaaacgaactcaataatcctctcttcgtcaatcaaacaatcatcgtgttaatttgctgaattacgattacttccgctatgatacagattccaggtggacgacgtgccggtgaggacgttcaagaagtacgacgacctggcgtacccgcagagcaagccgatgaggctgcacgcgacgctgtgggacggcagctactgggcgacgaggcacggcgacgtcaagatcgactggagcggcgcgccgttcgtggtgtcgtaccgcgggtacagcaccaacgcgtgcgtcaacaacaatcccgccggcgggtggtcgtcgtcgtggtgccccgagggcacgtcggcgtggatccaccgcgagctcgacggcgccgagctcggcaccgtcgcgtgggccgagcgcaactacatgtcctacaactactgcgccgacggctggcgcttcccccagggcttccccgccgagtgctaccgcaagtgattttgaactcgatcgattcaaatcctcctccattgatgagttcttggcaatgatttgtaattgcttcttgttcttgttttcgtcttcgtcttcgtcttcttcttcttgatccatgtacattttgccatccattcgttctccatttgttacagttacagagacaggttgatggtgaattactattgccgccaatttttttcttcttcttgttactcgatccaattattactactagagttcatcttgcacagttgggcggtgtgaaaaactgaaaaagaaaagggtgtcaaatttgttgctgatgctgagcaagtgagcacatgcttatgctctcaggtatgaacaaaataaacagtaaaattatctgc</dnaseqindica> |
| External Link(s) |

