Difference between revisions of "Os02g0734400"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
Line 9: Line 9:
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
 
Drought stress response gene can be divided into two categories,namely,action or regulation during the early signal-regulated protein and advanced adaptive functional proteins which could affect activity of other proteins.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance
 
Drought stress response gene can be divided into two categories,namely,action or regulation during the early signal-regulated protein and advanced adaptive functional proteins which could affect activity of other proteins.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance
 
Os02g0734400 contains introns,it is described Os02g0734400 is not originated  in retrotransposition events.It contains 6 extons.Through high density genetic maps,and combine the position information of the respective genomicoil body protein gene family of calcium,plotted on chromosome 6 relative positions of these oil-body protein gene of calcium.Os06g0254700 and Os02g0734400 are on the regionon of chromosome repilcation , which may be cause of chromosome replication.
 
Os02g0734400 contains introns,it is described Os02g0734400 is not originated  in retrotransposition events.It contains 6 extons.Through high density genetic maps,and combine the position information of the respective genomicoil body protein gene family of calcium,plotted on chromosome 6 relative positions of these oil-body protein gene of calcium.Os06g0254700 and Os02g0734400 are on the regionon of chromosome repilcation , which may be cause of chromosome replication.

Revision as of 03:10, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Os02g0734400 is a stress responsive gene. It encodes the caleosin which mainly lay in oil body or lipid body.These physiological and biochemical processes including regulation of genes involvedin stomatal closure, maintaining internal and external balance of water and ions,adjusting the synthesis and catabolism

Expression

Molecular weight of caleosins range from 15KD to 30KD.Caleosins have a significant feature that EF-hand domain in N-terminal can combine Ca2+,a central hydrophobic region and a security protein kinase phosphorylation sites in C-terminal.Caleosins's N-terminal and C-terminal are located in the cytoplasm,however central hydrophobic region are anchored in the phospholipid monolayer membrane.

Evolution

Drought stress response gene can be divided into two categories,namely,action or regulation during the early signal-regulated protein and advanced adaptive functional proteins which could affect activity of other proteins.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance Os02g0734400 contains introns,it is described Os02g0734400 is not originated in retrotransposition events.It contains 6 extons.Through high density genetic maps,and combine the position information of the respective genomicoil body protein gene family of calcium,plotted on chromosome 6 relative positions of these oil-body protein gene of calcium.Os06g0254700 and Os02g0734400 are on the regionon of chromosome repilcation , which may be cause of chromosome replication. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1 .Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217 2 .Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97: 111–119 3 .Kant P, Gordon M, Kant S, et al. Functional genomics-based identification of genes that regulate Arabidopsisresponses to multiple abiotic stresses. Plant Cell Environ, 2008, 31: 697–714 4 .Oono Y, Seki M, Nanjo T, et al. Monitoring expression profiles of Arabidopsis thalianagene expression during rehydration press after dehydration using ca. 7000 full-length cDNA microarray. Plant J, 2003, 34: 868–887

Structured Information

Gene Name

Os02g0734400

Description

Caleosin related family protein

Version

NM_001054574.2 GI:297599890 GeneID:4330643

Length

1439 bp

Definition

Oryza sativa Japonica Group Os02g0734400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:31518174..31519612

Sequence Coding Region

31518732..31518973,31519142..31519267,31519377..31519530

Expression

GEO Profiles:Os02g0734400

Genome Context

<gbrowseImage1> name=NC_008395:31518174..31519612 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:31518174..31519612 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgccctcggtaccaagaccagacctgtatgatctgtcacatctttatatatgtttcgtttggcgcataattcccctggttatgcgtgatataaagaaaaaaactgacagtttgtgctttttccaaatttccaaatgcacgcaggaaaatgcaacagcatcacggttttctatctatatagagaacatccacaaaggggtccatggaagtgatactggcgcattcgattcagaaggaaggtttgtcaatgaaaagttcgatgagatatttaccaagcatgcaaaaactgtacccgatggcctgacagcagccgaactggacgagatgcttcgtgcaaacagagaacccaaggactacaaaggatgggtcggagcatcgacggagtgggagacgacgttcaagctcgggaaggacaaggatggtttccttcgcaaggacactgtcagaactgtctacgatgggagcttcttcagtaaagtggcgtcgaagaagaagggtccctctgcaaaccaagcatga</cdnaseq>

Protein Sequence

<aaseq>MAPSVPRPDLYDLSHLYICFVWRIIPLVMRDIKKKTDSLCFFQI SKCTQENATASRFSIYIENIHKGVHGSDTGAFDSEGRFVNEKFDEIFTKHAKTVPDGL TAAELDEMLRANREPKDYKGWVGASTEWETTFKLGKDKDGFLRKDTVRTVYDGSFFSK VASKKKGPSANQA</aaseq>

Gene Sequence

<dnaseqindica>559..800#969..1094#1204..1357#caacaaatggaggttcgtcgacgatggtcgtctccggcgacggctgcggccatggctctcgtcctgttcgcctcgtcgtcctcctgtaaacgccctgtaacacacaatatcctctgtggcacgcgcgcgtgcgtgcgcgtctgatttgttggtctcgtgtctcgttaatttgcttactcgatcgctacgttttccattacgaatttgcgatcgatccgaggaaagggagcccggcggcggcggcggcggttggcgctgcgacggaactgcagaagcacgtggcgttcttcgacagcaaccacgacggcatcatctccttctccgagacgtacgaaggtgggtggccatgcctgtcctatcctccgttttctgcttgctaaatgtcaaacgcagccttatatctcccttaaattgttacagcataatttcttttaatatgttgtttcaattcaagggagatctaagactgcattttgatattttttttaatggtgcctgcagggttccgtgcgctcggatttggagttgttacctccagattcagcgcgaccgtaatcaatggcgccctcggtaccaagaccagacctgtatgatctgtcacatctttatatatgtttcgtttggcgcataattcccctggttatgcgtgatataaagaaaaaaactgacagtttgtgctttttccaaatttccaaatgcacgcaggaaaatgcaacagcatcacggttttctatctatatagagaacatccacaaaggggtccatggaagtgatactggcgcattcgattcagaaggaaggtagtcatttcgtagactctccaaacagtaatgatacaagcgagttcagcaaattgccttggattgtctgaactgtttgcaacatagattattcttttacgttcttccacacatataattcacaatcatctttttgatatgctagtagtatattcaactctgctgcaggtttgtcaatgaaaagttcgatgagatatttaccaagcatgcaaaaactgtacccgatggcctgacagcagccgaactggacgagatgcttcgtgcaaacagagaacccaaggactacaaaggatggtaatctcttgctagctgatagcttcagaaaccatatgcatgtatatctgttcaaatggtctgctcactgtattcgcttgcactacttttgtaccacgagaaaatgcagggtcggagcatcgacggagtgggagacgacgttcaagctcgggaaggacaaggatggtttccttcgcaaggacactgtcagaactgtctacgatgggagcttcttcagtaaagtggcgtcgaagaagaagggtccctctgcaaaccaagcatgattgggattttggaaggaaaaatgtactaaattgatagaacatgtcaaggcatccctaaaatgaatggtccatatatatttac</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0734400, RefSeq:Os02g0734400