Difference between revisions of "Os10g0533600"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
OsMPK6 functions as a negative regulator in rice resistance toXoo(Yuanet al., 2007). OsMPK6 can also function as a positive regulator in XooandXocresistance.
 
OsMPK6 functions as a negative regulator in rice resistance toXoo(Yuanet al., 2007). OsMPK6 can also function as a positive regulator in XooandXocresistance.
Thus OsMPK6 appears to be a two-faced player in the host– Xoointeraction. Although a few pathogen-induced defenseresponsive genes have been reported to have opposing functions in plant–pathogen interactions, the dual functions were observed in host responses to different pathogens (Brodersen et al., 2006; Li et al., 2006; Zhang et al., 2007). OsMPK6stands out by showing opposite functions in response to the same pathogen, which provides a new view for elucidating the molecular mechanisms of plant defense responses.
+
Thus OsMPK6 appears to be a two-faced player in the host– Xoointeraction. Although a few pathogen-induced defense responsive genes have been reported to have opposing functions in plant–pathogen interactions, the dual functions were observed in host responses to different pathogens (Brodersen et al., 2006; Li et al., 2006; Zhang et al., 2007). OsMPK6 stands out by showing opposite functions in response to the same pathogen, which provides a new view for elucidating the molecular mechanisms of plant defense responses.
  
 
===Expression===
 
===Expression===

Revision as of 03:29, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsMPK6 functions as a negative regulator in rice resistance toXoo(Yuanet al., 2007). OsMPK6 can also function as a positive regulator in XooandXocresistance. Thus OsMPK6 appears to be a two-faced player in the host– Xoointeraction. Although a few pathogen-induced defense responsive genes have been reported to have opposing functions in plant–pathogen interactions, the dual functions were observed in host responses to different pathogens (Brodersen et al., 2006; Li et al., 2006; Zhang et al., 2007). OsMPK6 stands out by showing opposite functions in response to the same pathogen, which provides a new view for elucidating the molecular mechanisms of plant defense responses.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research(Wuhan), Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Pathology and Program in Cell and Molecular Biology, University of Arkansas, Fayetteville, AR 72701, U.S.A.

References

  • 1. Xiangling Shen;Bin Yuan;Hongbo Liu;Xianghua Li;Caiguo Xu;Shiping Wang
 Opposite functions of a rice mitogen-activated protein kinase during the process of resistance against Xanthomonas oryzae
 The Plant Journal, 2010, 64(1): 86-99
  • 2. Bin Yuan;Xiangling Shen;Xianghua Li;Caiguo Xu;Shiping Wang
 Mitogen-activated protein kinase OsMPK6 negatively regulates rice disease resistance to bacterial pathogens
 Planta, 2007, 226(4): 953-960
  • 3. Nathan S. Reyna;Yinong Yang
 Molecular Analysis of the Rice MAP Kinase Gene Family in Relation to Magnaporthe grisea Infection
 Molecular Plant-Microbe Interactions, 2006, 19(5): 530-540

Structured Information

Gene Name

Os10g0533600

Description

Similar to Mitogen-activated protein kinase homolog MMK2 (EC 2.7.1.37)

Version

NM_001071691.1 GI:115483125 GeneID:4349225

Length

3758 bp

Definition

Oryza sativa Japonica Group Os10g0533600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:21211470..21215227

Sequence Coding Region

21211637..21211809,21212079..21212208,21213233..21213370,21213552..21213884,21214102..21214285
,21214359..21214531

Expression

GEO Profiles:Os10g0533600

Genome Context

<gbrowseImage1> name=NC_008403:21211470..21215227 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:21211470..21215227 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggattcctcctccggcggcgcgggcggcggcggcggcgcgcagatcaaggggatggggacgcacgggggccgctacgtgctgtacaacgtgtacgggaacttcttcgaggtctcctccaagtacgcccctcccatccgccccatcggccggggcgcctacggcattgtctgcgcggctgttaactcggagaacggcgaggaagttgccatcaagaagattggcaatgcattcgacaaccatatcgatgccaagcggacactgagagaaatcaagctgcttcgccacatggaccacgagaatattattgccataaaggacataattcgccccccaagaagagacaactttaatgatgtttacattgtttctgagttgatggatactgatctccatcagatcatacgctcaaatcaaccattgactgatgaccactgccagtacttcctgtaccagttgctacgagggctaaaatatgtgcactcggcaaatgtcttgcaccgtgatctgaagccaagcaatttgttccttaatgcaaattgtgatctcaagattgctgattttgggcttgcaagaaccactacggagactgacctcatgacagagtatgtggtcactcgttggtatcgagcaccagagctgctgttgaactgctcgcagtatactgctgctattgatgtctggtcagttggatgcatacttggtgaaattgtgactcgtcaacccctgtttcctggaagggattacattcagcaactaaaattgatcactgagctgatagggtcgccagatgactcaagcctagggtttcttcggagtgataatgcaagaagatacatgaaacagctaccacagtacccaaggcaggacttccgcttgcgcttccgcaacatgtctgctggtgcagtcgatctgttagagaaaatgctggtgtttgacccaagcagacggataactgttgatgaggctcttcatcacccatacttggcttctcttcatgacatcaatgaagaacccacctgcccagcacctttcagctttgattttgagcaaccatcctttactgaagaacatataaaagaactcatctggagggaatccttggcatttaatccggatcctccctactaa</cdnaseq>

Protein Sequence

<aaseq>MDSSSGGAGGGGGAQIKGMGTHGGRYVLYNVYGNFFEVSSKYAP PIRPIGRGAYGIVCAAVNSENGEEVAIKKIGNAFDNHIDAKRTLREIKLLRHMDHENI IAIKDIIRPPRRDNFNDVYIVSELMDTDLHQIIRSNQPLTDDHCQYFLYQLLRGLKYV HSANVLHRDLKPSNLFLNANCDLKIADFGLARTTTETDLMTEYVVTRWYRAPELLLNC SQYTAAIDVWSVGCILGEIVTRQPLFPGRDYIQQLKLITELIGSPDDSSLGFLRSDNA RRYMKQLPQYPRQDFRLRFRNMSAGAVDLLEKMLVFDPSRRITVDEALHHPYLASLHD INEEPTCPAPFSFDFEQPSFTEEHIKELIWRESLAFNPDPPY</aaseq>

Gene Sequence

<dnaseqindica>168..340#610..739#1764..1901#2083..2415#2633..2816#2890..3062#attccgcggtcgccgcccgagtcaaaaagagggggaagcttctcccaccatagtcctcctcctcctcctcctactcccatcaacgactagtcgcggcgaccaagagccaaaccctacgcctcctcccctccccctccacctcgtcctccccgcgagcggcggcggccatggattcctcctccggcggcgcgggcggcggcggcggcgcgcagatcaaggggatggggacgcacgggggccgctacgtgctgtacaacgtgtacgggaacttcttcgaggtctcctccaagtacgcccctcccatccgccccatcggccggggcgcctacggcattgtctggtgcgtttgcctcgccctcccctcccctcccgagttatgcgtgtgggtttactaattaatagcgaatccgagttgctatttttgttcgaaaattcgcgagggcgtttatgtgttcgtgacacatcgcgtagatttggctccggatgttgtgttttaggcataaggatgtgtgggggaaatgggtcacggcggcccaaaaatgttatggtttgactgcttgagtagatgtgattatattgtagtagtaattttgtttttcctatttgtagcgcggctgttaactcggagaacggcgaggaagttgccatcaagaagattggcaatgcattcgacaaccatatcgatgccaagcggacactgagagaaatcaagctgcttcgccacatggaccacgagaatgtaagagctgtttgtttaaattggttttcgacattcctagtgattattgatcgaacttggccttaccactattaggtaatttattgggtgtgatttacatttagtttacattggtaactaacttttcctaaggacatttttcgagtgcaaacaccatattccataatttgttagaaaagcggcagcaacactttagacctttctgtagttacttacttgcttgtaaagagtgcattactaattgctattattggttatgatagattaattgtactccactgaaagatcatcctatcccttatattccactcattgcttcactcatactctgctatcaagttgtgtgactagttggactagtcgacaagtcatccaaggggcatgacttaacttgttggcagcagaagatgctatggagtaagggcagcatcaatgagccactattgagcaaattgggcctcgcttgggaggcctggtgcatcgggcccattgttaatgagtgaaacagagaggagaggcaaacagattaacagtagaggcaatcggtatatatatgttgtaatggtctaatagaccagtcaaccagaacaatagtcctaactagccacaactagtcgggcaagtcagcagagggatgactcaactcgactttacgatttaacaaccttgcactcatgtgggccgtaggggatgtcaacactcttatacttacaaagaactgctatgctacaagtggaatacttcatctttagtcgtttcattactaagtcatagtagtgccagatccaagccaggatgttgtacataaggagtaaccttgggctcagctgacaccatatgtttattaggtttctatctctacaggtagttttgtttgctttatttaaacatacaaactggaatgtggttttcactttctgttatttccttttttttttgttgggcggtcaagagcgtgtgatacatttttgactcacacatttatatcatatagtctgatggtgattttaacactggatcacagattattgccataaaggacataattcgccccccaagaagagacaactttaatgatgtttacattgtttctgagttgatggatactgatctccatcagatcatacgctcaaatcaaccattgactgatgaccactgccaggtttgttgcttccagcttgtgctttgctgaaacattttgcttgcagaaaatctagacagagatttccatgcaccttgttcctttggtcgctatatgttttcttcatcctatccatatttcagcttaacattctcttgtttatctggtttaataatcacaagtgacatgttttgcattgcagtacttcctgtaccagttgctacgagggctaaaatatgtgcactcggcaaatgtcttgcaccgtgatctgaagccaagcaatttgttccttaatgcaaattgtgatctcaagattgctgattttgggcttgcaagaaccactacggagactgacctcatgacagagtatgtggtcactcgttggtatcgagcaccagagctgctgttgaactgctcgcagtatactgctgctattgatgtctggtcagttggatgcatacttggtgaaattgtgactcgtcaacccctgtttcctggaagggattacattcagcaactaaaattgatcactgaggtaaggcttgtctggttcattgcttgcatacttttaatgtctgcataaacgtaattttttatttgtacttgaataagagatacattacttgaactctgaatatgtaaatgtgtttttttttgggtccatttttttttctgttttctttgcttttctaaaatgtatccctgtaacccaagtggtatcaatattaatcagacccttttctcttcaaaagctgatagggtcgccagatgactcaagcctagggtttcttcggagtgataatgcaagaagatacatgaaacagctaccacagtacccaaggcaggacttccgcttgcgcttccgcaacatgtctgctggtgcagtcgatctgttagagaaaatgctggtgtttgacccaagcagacggataactggtacattgactttacaccaactactccacttttgttgcctttactgtaaattgaacattatttttccatgcagttgatgaggctcttcatcacccatacttggcttctcttcatgacatcaatgaagaacccacctgcccagcacctttcagctttgattttgagcaaccatcctttactgaagaacatataaaagaactcatctggagggaatccttggcatttaatccggatcctccctactaagagctcaggttcgttctagagaaccaatgatctaaaatattgtagatggctaattctagcatcctgcagagattttttgaagacttcatatggatagttttccagattgactaatttagaccctgggagaatgaatgttcttttaaagccaaacaaatgcctattccactgcgattttatactcgtaatataccattgcataaaattctgttcataactcaagtttatgagacaaaactattctatacctttttgccacaaatttcatgttttctgataattctcaacagtcaatatgctcacttcaccattttgaatgttacctccctgttaagatctgctttgaagaattcaaatgctaatttgccatacctgcacatttcaaaaatgaaattcctcatttaatctctaaccttttgcatttcttttgccttgagtgcagagcaatttatcaatgctggcatctgaagatcggtagctctagaaaagccaaatccccttgctttgtgcatctattaattttatgcccacttgttgggcgaatgagcatggattattgttatagtgacaatttttcttaaggcctgtctaaagaaacaacatttgtattccttatcagatagcctgaacttgggcctgtattataccggttgattgcataactgttcttatgtatctaagcctgtaattgtcttc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0533600, RefSeq:Os10g0533600