Difference between revisions of "Os10g0167600"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Function)
Line 5: Line 5:
 
Protein: Cyclobutane pyrimidine dimer (CPD) photolyase
 
Protein: Cyclobutane pyrimidine dimer (CPD) photolyase
 
===Function===
 
===Function===
Repair of CPDs is essential for plant survival while exposed to UV-B-containing sunlight. Nuclear repair of the UV-B-induced CPDs involves the photoreversal of CPDs, photoreactivation, which is mediated by CPD photolyase that monomerizes the CPDs in DNA by using the energy of near-UV and visible light (300–500 nm).There are two kinds of CPD pthotolyase existed in rice leaves. One is 54kD and another is 56kD protein. The 56-kD native rice CPD photolyase was phosphorylated, which has significantly higher CPD photorepair activity. The native rice CPD photolyase possesses both a pterin-like chromophore and an FAD chromophore.
+
Repair of CPDs is essential for plant survival while exposed to UV-B-containing sunlight. Nuclear repair of the UV-B-induced CPDs involves the photoreversal of CPDs, photoreactivation, which is mediated by CPD photolyase that monomerizes the CPDs in DNA by using the energy of near-UV and visible light (300–500 nm).There are two kinds of CPD pthotolyase existed in rice leaves. One is 54kD and another is 56kD protein. The 56-kD native rice CPD photolyase was phosphorylated, which has significantly higher CPD photorepair activity. The native rice CPD photolyase possesses both a pterin-like chromophore and an FAD chromophore. Single amino acid alteration from glutamine to arginine leads to a deficit of CPD photolyase activity and that CPD photolyase activity is one of the main factors determining UVB sensitivity in rice.
  
 
===Expression===
 
===Expression===

Revision as of 05:13, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Gene:OsCPDP; qUVR-10 Protein: Cyclobutane pyrimidine dimer (CPD) photolyase

Function

Repair of CPDs is essential for plant survival while exposed to UV-B-containing sunlight. Nuclear repair of the UV-B-induced CPDs involves the photoreversal of CPDs, photoreactivation, which is mediated by CPD photolyase that monomerizes the CPDs in DNA by using the energy of near-UV and visible light (300–500 nm).There are two kinds of CPD pthotolyase existed in rice leaves. One is 54kD and another is 56kD protein. The 56-kD native rice CPD photolyase was phosphorylated, which has significantly higher CPD photorepair activity. The native rice CPD photolyase possesses both a pterin-like chromophore and an FAD chromophore. Single amino acid alteration from glutamine to arginine leads to a deficit of CPD photolyase activity and that CPD photolyase activity is one of the main factors determining UVB sensitivity in rice.

Expression

full-length CPD photolyase is encoded by a single gene, not a splice variant, and is expressed and targeted not only to nuclei but also to chloroplasts and mitochondria.

Evolution

Rice may have evolved a CPD photolyase that functions in chloroplasts, mitochondria and nuclei, and that contains DNA to protect cells from the harmful effects of UV-B radiation. The amino acid at position 126 of the deduced amino acid sequence of CPD photolyase in cultivars including such as Norin 1 was found to be arginine, the CPD photolyase activities of which were lower. The amino acid at that position in cultivars including such as Sasanishiki was glutamine, which has higher CPD photolyase activities.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0167600

Description

Similar to CPD photolyase

Version

NM_001189112.1 GI:297727354 GeneID:9272017

Length

3900 bp

Definition

Oryza sativa Japonica Group Os10g0167600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:4343782..4347681

Sequence Coding Region

4343990..4344169,4344287..4344358,4344993..4345074,4345697..4345755,4345844..4345880
,4346001..4346035

Expression

GEO Profiles:Os10g0167600

Genome Context

<gbrowseImage1> name=NC_008403:4343782..4347681 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:4343782..4347681 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgctgctgataaaagagagcatatctatacgtgagagggaacagcttgagaatgccaaaacacatgatcctttgtggaatgcatcgcagttggagatggttcaccatggaaaaatgcatggattcatgagaatgtactgggccaaaaagattctagaatggactagtggaccagaagaagcactttcaactgcaatttatttaaatgacaagtatgagatagatggcagggaccccagtggttacgtcggatgtatgtggtccatatgtggcctccatgatcagggttggaaggagcgtccagtatttggaaagatacgttacatgaattacgctggctgcaagagaaaattcgatgttgacgcttacatttcttatgtcaagagattagctggtcaatccaagaagaggaacgctgaggagtctccaaatcctgtagtcaagctttccaagtctcagcactaa</cdnaseq>

Protein Sequence

<aaseq>MLLIKESISIREREQLENAKTHDPLWNASQLEMVHHGKMHGFMR MYWAKKILEWTSGPEEALSTAIYLNDKYEIDGRDPSGYVGCMWSICGLHDQGWKERPV FGKIRYMNYAGCKRKFDVDAYISYVKRLAGQSKKRNAEESPNPVVKLSKSQH</aaseq>

Gene Sequence

<dnaseqindica>3513..3692#3324..3395#2608..2689#1927..1985#1802..1838#1647..1681#aattcacacccacaaacgcacgcccgcacgcgcgcgcgcgcgctcagagacctccgtcgccgcccgccgcacgccggcgacccaccgcgccgcacgatgccgccgacctcagtgagcccaccaagaacagcgccggggccggcgaacccgagcccggcacacccgtcccgcgtgcgggtgatccacccgggcggcgggaagcccggtgggccggtggtgtactggatgctgcgggaccagcggctcgccgacaactgggcgctcctccacgccgccggcctcgccgccgcctccgcgtccccgctcgccgtcgcgttcgcgctgttcccgaggcccttcctcctctccgcccgccgccgccagctcgggttcctcctccgcggcctccgccgcctcgccgccgacgccgccgcccgccacctccccttcttcctcttcaccggtacgcgcccttttctttttctttttctttttctttttcttttgtctccatccgtgacgatgacatgtgggccaccccgtcttgcgaaatgtgacgtggctttttctctggctcgctgacaggtgggcccgcggagatcccggcgctggtgcggcgccttggtgcgtcgacgctggtcgccgacttctcgccgctgcggccggtgagggaggcgctcgacgcggtggtcggcgacctgcggcgggaggcgcccggcgtggccgtgcaccaggtgagcgtggtggcattgctgtttgcatcaatcttccaagaaagttgggaatctttttggggatggataatgaattcgccggagaatttagagattcttgtggaattcttcgaatgcaggtggacgcgcacaacgtggtgcctgtgtggacggcgtcggcgaagatggagtattcagccaagaccttcagaggcaaggtgagcaaggtgatggatgagtaccttgtggagttccctgaattgccggcggtggtgccatgggacagggagcagccggagggggtcgactgggacgcactcatcgccagggtttgcaggtgcggatgataattctaaggtgtattgggtggtaattttgtttgtgtagatatggatgactattgattcttggttgtttgagcagtgaggcggagaatgtgccggagattgactggtgtgagcctggagaggaagcagccatagaggcgcttctcggcagcaaggatggattcctgacgaagaggatcaagagctatgaaactgaccggaatgatcccacgaaaccacgggcattgtctgggctttcaccataccttcattttgggcacatttcggcacagcggtgtgcgctcgaggcaaagaaatgccgacatcttagtcccaaggtgctgttctttaactgatttgttatgattaaaagagttatgatcctcttgcaatgtaataaattgttagatggcattgtttttctttaccgtgaactggctagaattcttagtgatgttgtttacctaatagatgtttgaagtaacatgtgttctgaaacagtccgtcgatgctttcttggaggaattggttgtaaggagggaattagctgacaacttctgctattaccaacctcaatatgattcgctgtctggtgcatgggaatgggcaaggaagacactgatggatcatgctgctgataaaagagagcatatctatacgtgagtaagttgccctttataatttattgtcacaattttaaccaaattatcttcctgacgatgttaaggtaaaagatcttcgctctaattggttatttgttaattgtcattttgttttggctaggagggaacagcttgagaatgccaaaacacatgatcctgtaagtgctattggacgtggtgtactctgttgctgatattgaagttactctaacacactgagttattttttttctaaatgattatcagttgtggaatgcatcgcagttggagatggttcaccatggaaaaatgcatggattcatgaggtaatatatcatgaccagactcttacaaaatcacgcaattataaaatgtttattgaacagttttttttttatgaaactgcttgttatatttcttctgtacccatggcacattctagttagttgcccataacctattggcccacttgttgacaacatatggttattttacccatcatactgatggtgtggtgctaacctaaaggcattggattgcccccaccccatctttgctgacataactgattagtttgctttgttggatagatgggaattttctgacgttgtggtttactttatcctatgtcagaaaatatgaagttatttgaaaaaaagcattccttaaaaaattagttttctgtagagtttgtgtagttccaataaatttatgatgatctatgtgatatgtctggtagcaagcctttggtgcacataattctctttgattctgggcaaaccttttacactatttttgttcaacttttgttttggatctggaaagaaagaaaagtaagttgttttggcgaacatcaaagaatgatgttatatctaattgattcttagttctgaaggtaacagtgcctgtaaggactttttcctttcctaatgtagtagttgtctgtagaatgtactgggccaaaaagattctagaatggactagtggaccagaagaagcactttcaactgcaatttatttaaatgacaaggtaagacctatacacatgtttgggaaatacagttgtgttattttgaatttgtcctttttatagttttgctagttgtagttaaaatagctatatttcaacacatggaacatgataaagaaacatggaacatgataaagaaactgctcacatgaaaaattgtaattgaatagcaacttggaagagtctgcccatgcttaaattagttcctgcgccgataaccgaaaagttggagtcacatttatcaaattaagaaatatataatttgacattcttttcatgtaaggcagaaaattgtatggttggtgctcttttcattatcttatcttcccttaagttaaaaacatcatccttctagggacaaccagacaataaatcagcttcacggtcgcctcggataagctggactatcctttttcttggttacctgtcagaagaaagatacaaaacagtaactggggaaataaattttcaggaatgtgaaattgctcgaagatattttcatagttgaacctacaattctttccccagctggattgttctcgttctttaataggagtagttgtttgcattgaagtacttctacggattttatttatgcttttcaacaaagtcttacaaatcaatcttgtggcagtatgagatagatggcagggaccccagtggttacgtcggatgtatgtggtccatatgtggcctccatgatcaggtcattgtgttatcacttctcacttcacagggaaaaacaattttgcttttcacaagcattagattgttggtgacattctagaagcgagtattccttacaccactgctgttttctcagggttggaaggagcgtccagtatttggaaagatacgttacatgaattacgctggctgcaagagaaaattcgatgttgacgcttacatttcttatgtcaagagattagctggtcaatccaagaagaggaacgctgaggagtctccaaatcctgtagtcaagctttccaagtctcagcactaaatccgactaggaaaatatgaacatttctttgtgtggtataccacgagctcggaaaattgaagaacagtgctaacttgaggtagatcatgtagggtatacactgtagatctgtttgtctgatatccttgtaggcttctaatcattcaaaatttgctagcattgttaagactttaagacatacagtgtcacaccagttgaattcaagtgt</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0167600, RefSeq:Os10g0167600