Difference between revisions of "Os06g0254700"

From RiceWiki
Jump to: navigation, search
(References)
Line 18: Line 18:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 +
1  Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217
 +
2  Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97:
 +
111–119
 +
3  Kant P, Gordon M, Kant S, et al. Functional genomics-based identification of genes that regulate Arabidopsisresponses to multiple abiotic
 +
stresses. Plant Cell Environ, 2008, 31: 697–714
 +
4  Oono Y, Seki M, Nanjo T, et al. Monitoring expression profiles of Arabidopsis thalianagene expression during rehydration press after
 +
dehydration using ca. 7000 full-length cDNA microarray. Plant J, 2003, 34: 868–887
 +
5  Kreps J A, Wu Y J, Chang H S, et al. Transcriptome changes for Arabidopsis in response to salt, osmotic and cold stress. Plant Physiol,
 +
2002, 130: 2129–2141
  
 
==Structured Information==
 
==Structured Information==

Revision as of 05:24, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1 Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217 2 Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97: 111–119 3 Kant P, Gordon M, Kant S, et al. Functional genomics-based identification of genes that regulate Arabidopsisresponses to multiple abiotic stresses. Plant Cell Environ, 2008, 31: 697–714 4 Oono Y, Seki M, Nanjo T, et al. Monitoring expression profiles of Arabidopsis thalianagene expression during rehydration press after dehydration using ca. 7000 full-length cDNA microarray. Plant J, 2003, 34: 868–887 5 Kreps J A, Wu Y J, Chang H S, et al. Transcriptome changes for Arabidopsis in response to salt, osmotic and cold stress. Plant Physiol, 2002, 130: 2129–2141

Structured Information

Gene Name

Os06g0254700

Description

Caleosin related family protein

Version

NM_001063839.1 GI:115467409 GeneID:4340665

Length

2956 bp

Definition

Oryza sativa Japonica Group Os06g0254700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:8010880..8013835

Sequence Coding Region

8011087..8011234,8011335..8011460,8012161..8012258,8013057..8013142,8013279..8013434
,8013594..8013627

Expression

GEO Profiles:Os06g0254700

Genome Context

<gbrowseImage1> name=NC_008399:8010880..8013835 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:8010880..8013835 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcctccaaacccgcggacgttacggctacaggtggcggcggcgtcgccgtcgtccgtgacaacaacaacaacgccggcggcggcgaggcggaggtgtaccgctccgagctgacgccgctgcagaagcacgtcgccttcttcgaccgcaacaaggacggcatcatctacccctccgagacctaccaagggttccgcgcaatcggggcaggagtcgtgctgtccgccgtcggcgccgtgttcatcaatggcggacttgggcccaagacgataccggagaacaccaagactggtctcaagttacccatatacgtcaagaacatccacaaaggcaagcatggaagcgattcaggcgtgtatgatgcgaatggaaggtttgtcccagaaaagttcgaggaaatattcaagaagcatgctcacaccaggcctgatgccctaacagacaaagagctgaaggagttgctccaatcaaacagggagcctaaagatttcaaaggatggttgggtggcttcacagagtggaaagtattgtactacctctgcaaagacaaggatggatttcttcacaaggatactgtcagggcagtctatgatggaagcctatttgcaaagatggagcaagagaagcagtctgctaagaagaaatga</cdnaseq>

Protein Sequence

<aaseq>MASKPADVTATGGGGVAVVRDNNNNAGGGEAEVYRSELTPLQKH VAFFDRNKDGIIYPSETYQGFRAIGAGVVLSAVGAVFINGGLGPKTIPENTKTGLKLP IYVKNIHKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDALTDKELKELLQSNRE PKDFKGWLGGFTEWKVLYYLCKDKDGFLHKDTVRAVYDGSLFAKMEQEKQSAKKK</aaseq>

Gene Sequence

<dnaseqindica>2602..2749#2376..2501#1578..1675#694..779#402..557#209..242#agcgaggcatccaccaccatcagccaaagtgccaaacgatcgatcgatctctgcagtctgcagattagcccaccacctccagcatcgggtccacgaatgcacaccctgtcaactccactccacccgcttttctttccctctccccgccaccttcacatctcaacctttcctctccctctctctctctctctctgatctcgtcgttcccatggcctccaaacccgcggacgttacggctacaggtgagccatctatctacatacacacgtcctcgtagtaacgcgccatggctgctgcttcttcttcttcttcttcgtctgcttattatggcggcgcgaataaatctgtcgcgttccttgtcgccaccgtcgtcaccgtgcctctgtgtgccctgctgctaggtggcggcggcgtcgccgtcgtccgtgacaacaacaacaacgccggcggcggcgaggcggaggtgtaccgctccgagctgacgccgctgcagaagcacgtcgccttcttcgaccgcaacaaggacggcatcatctacccctccgagacctaccaaggtttcagctcacgcagccaccaccaccgatcgatcccctttcctcttcactgttcacacagcgattattttcttcatgatttttttctttttctcaagcgttcgattcgttcgttcgttgctgcgcttgcttgcagggttccgcgcaatcggggcaggagtcgtgctgtccgccgtcggcgccgtgttcatcaatggcggacttgggcccaagacgataccggtcagtacaacagctgcagacatcaaatctccctctctgtctcaattcaatgttactgttttcttgcatactgccaaagtgccaacgctttgctttgctcgctctgcgccaaaacatgaactgtctttttttttttttgtctagttgttgcaagctactatctgggtatgcacaggtgtttcttagttcaatttcacagtttgggtactgtttcttcgttcagttcatcgacaatatttcagtagatgagcacaacaaactaatatctcctgccactaattttccatttctgttgcacaagccataggcccgtagctaagcgcgtctcatggttaagaaaaagaagatacaatttcttttacaatatttattcagatcggtgttaaaagtatcaaacgattaggaaactactaaacgagaaacgtattcgtaacgtggaatatataccaatgccagcacctacattgcaagggaaagatacctcctttaattcggaaaaagaaagagaaagcactgatgaagcaccactgcactgataagataactgaaaagaaagagaacaccaatgggccacgcattattgcataatatcgatagacacggacaatacaactgcattttcttgtgtgtactggacagagtaaagtctcaggctcagctcacttttctgttgcctctttaatcttttcaaattgactttgaaacagagacacgaaatggggattgatttagttgcacgaactatttactgatgctgactctcgtttaccatttttcaacctcactgctttactgtaggagaacaccaagactggtctcaagttacccatatacgtcaagaacatccacaaaggcaagcatggaagcgattcaggcgtgtatgatgcgaatggaaggtacctttctatattattatgtttttaagctgaaggtaccttaatttctttatgtgtcagcatcagtatgaacatgactcatgcggccagcacagatgtcagatgtttaattgggcttaatcgctttgtcgttgtactttactcatcaagattaggataaattaagccagcacctaaccataaagtaacacagacgcggatgaattgcttaacaaacaggagaactgaatcgcctttttcatgtggcatggtgatgcagagatttgagggatatcacccggccaaaaagatttgagagatatctgtttattaggcactttagttgtctgttccttctgtcaaaagctagtgaagatgcatccaaactatagttctaagagagatcacgcataatatgaaatcaaagatatggttgtttcattttctttagaacacttggttgttccattgcatgcatagtttaatacgtgtgaaatgcacatggtgaaaaaaatattgccactaagactcatggtatcacattgagatctataagcttttaggatcactatgcagtgaggctatcactgctgttgttttcttattgtttttgtttcaatgcgaacaaacaaaggcacttgtcttagctagagtcgtaaaaataatgcaatagggtaacatggatctagatttgctaaccacacaatatgtacacttgcaggtttgtcccagaaaagttcgaggaaatattcaagaagcatgctcacaccaggcctgatgccctaacagacaaagagctgaaggagttgctccaatcaaacagggagcctaaagatttcaaaggatggtgagttctcatctagattaagactgtaagaacaatggtaaaatgaagttatgttttgtccatgctcatccttttttttctttgggggaaaacgttgcaggttgggtggcttcacagagtggaaagtattgtactacctctgcaaagacaaggatggatttcttcacaaggatactgtcagggcagtctatgatggaagcctatttgcaaagatggagcaagagaagcagtctgctaagaagaaatgataagaccatactgggtgctgtaattatctgttattgttgcaggtgattgtaaattacggtgtgggtgtgaatccaaaattattgctgtagtttgattgcgcgtgtttgttgacccgttcctgtaacaagaagctatttgtgaagttattggaagtgtttgtaaacatggtggtatcctctgatttattcacttcatttttttctttt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0254700, RefSeq:Os06g0254700