Difference between revisions of "Os06g0254700"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
 
+
Os06g0254700 encode a caleosin
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===

Revision as of 05:42, 9 June 2014

Please input one-sentence summary here. Os06g0254700 encode a caleosin

Annotated Information

Function

Please input function information here. Os06g0254700 is a stress responsive gene. It encodes the caleosin which mainly lay in oil body or lipid body.These physiological and biochemical processes including regulation of genes involvedin stomatal closure, maintaining internal and external balance of water and ions,adjusting the synthesis and catabolism.Caleosins not only promote formation of oil body but also is related to drought stress.

Expression

Please input expression information here. It is located on chromosome 6.There are two other caleosin genes-Os06g0254300 and Os06g0254600 in chromosome 6.These three genes get together because tandem duplication.Caleosins have a significant feature that EF-hand domain in N-terminal can combine Ca2+,a central hydrophobic region and a security protein kinase phosphorylation sites in C-terminal.Caleosins's N-terminal and C-terminal are located in the cytoplasm,however central hydrophobic region are anchored in the phospholipid monolayer membrane.

Evolution

Please input evolution information here. Six caleosin genes in rice distribute on four different chromosomes.Os06g0254300,Os06g0254600, OsCLO-6 three genes are located to adjacent position of chromosome 6.Homology of Os06g0254300 and Os06g0254600reach to 92%,Os06g0254600 and Os06g0254700 is 49%.Indicating that Os06g0254300 and Os06g0254600 originated in a close repeated events, but Os06g0254700 and Os06g0254600 repeated earlier.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance Os06g0254700 contains introns,it is described Os06g0254700 is not originated in retrotransposition events. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1 Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217 2 Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97: 111–119 3 Kant P, Gordon M, Kant S, et al. Functional genomics-based identification of genes that regulate Arabidopsisresponses to multiple abiotic stresses. Plant Cell Environ, 2008, 31: 697–714 4 Oono Y, Seki M, Nanjo T, et al. Monitoring expression profiles of Arabidopsis thalianagene expression during rehydration press after dehydration using ca. 7000 full-length cDNA microarray. Plant J, 2003, 34: 868–887 5 Kreps J A, Wu Y J, Chang H S, et al. Transcriptome changes for Arabidopsis in response to salt, osmotic and cold stress. Plant Physiol, 2002, 130: 2129–2141

Structured Information

Gene Name

Os06g0254700

Description

Caleosin related family protein

Version

NM_001063839.1 GI:115467409 GeneID:4340665

Length

2956 bp

Definition

Oryza sativa Japonica Group Os06g0254700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:8010880..8013835

Sequence Coding Region

8011087..8011234,8011335..8011460,8012161..8012258,8013057..8013142,8013279..8013434
,8013594..8013627

Expression

GEO Profiles:Os06g0254700

Genome Context

<gbrowseImage1> name=NC_008399:8010880..8013835 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:8010880..8013835 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcctccaaacccgcggacgttacggctacaggtggcggcggcgtcgccgtcgtccgtgacaacaacaacaacgccggcggcggcgaggcggaggtgtaccgctccgagctgacgccgctgcagaagcacgtcgccttcttcgaccgcaacaaggacggcatcatctacccctccgagacctaccaagggttccgcgcaatcggggcaggagtcgtgctgtccgccgtcggcgccgtgttcatcaatggcggacttgggcccaagacgataccggagaacaccaagactggtctcaagttacccatatacgtcaagaacatccacaaaggcaagcatggaagcgattcaggcgtgtatgatgcgaatggaaggtttgtcccagaaaagttcgaggaaatattcaagaagcatgctcacaccaggcctgatgccctaacagacaaagagctgaaggagttgctccaatcaaacagggagcctaaagatttcaaaggatggttgggtggcttcacagagtggaaagtattgtactacctctgcaaagacaaggatggatttcttcacaaggatactgtcagggcagtctatgatggaagcctatttgcaaagatggagcaagagaagcagtctgctaagaagaaatga</cdnaseq>

Protein Sequence

<aaseq>MASKPADVTATGGGGVAVVRDNNNNAGGGEAEVYRSELTPLQKH VAFFDRNKDGIIYPSETYQGFRAIGAGVVLSAVGAVFINGGLGPKTIPENTKTGLKLP IYVKNIHKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDALTDKELKELLQSNRE PKDFKGWLGGFTEWKVLYYLCKDKDGFLHKDTVRAVYDGSLFAKMEQEKQSAKKK</aaseq>

Gene Sequence

<dnaseqindica>2602..2749#2376..2501#1578..1675#694..779#402..557#209..242#agcgaggcatccaccaccatcagccaaagtgccaaacgatcgatcgatctctgcagtctgcagattagcccaccacctccagcatcgggtccacgaatgcacaccctgtcaactccactccacccgcttttctttccctctccccgccaccttcacatctcaacctttcctctccctctctctctctctctctgatctcgtcgttcccatggcctccaaacccgcggacgttacggctacaggtgagccatctatctacatacacacgtcctcgtagtaacgcgccatggctgctgcttcttcttcttcttcttcgtctgcttattatggcggcgcgaataaatctgtcgcgttccttgtcgccaccgtcgtcaccgtgcctctgtgtgccctgctgctaggtggcggcggcgtcgccgtcgtccgtgacaacaacaacaacgccggcggcggcgaggcggaggtgtaccgctccgagctgacgccgctgcagaagcacgtcgccttcttcgaccgcaacaaggacggcatcatctacccctccgagacctaccaaggtttcagctcacgcagccaccaccaccgatcgatcccctttcctcttcactgttcacacagcgattattttcttcatgatttttttctttttctcaagcgttcgattcgttcgttcgttgctgcgcttgcttgcagggttccgcgcaatcggggcaggagtcgtgctgtccgccgtcggcgccgtgttcatcaatggcggacttgggcccaagacgataccggtcagtacaacagctgcagacatcaaatctccctctctgtctcaattcaatgttactgttttcttgcatactgccaaagtgccaacgctttgctttgctcgctctgcgccaaaacatgaactgtctttttttttttttgtctagttgttgcaagctactatctgggtatgcacaggtgtttcttagttcaatttcacagtttgggtactgtttcttcgttcagttcatcgacaatatttcagtagatgagcacaacaaactaatatctcctgccactaattttccatttctgttgcacaagccataggcccgtagctaagcgcgtctcatggttaagaaaaagaagatacaatttcttttacaatatttattcagatcggtgttaaaagtatcaaacgattaggaaactactaaacgagaaacgtattcgtaacgtggaatatataccaatgccagcacctacattgcaagggaaagatacctcctttaattcggaaaaagaaagagaaagcactgatgaagcaccactgcactgataagataactgaaaagaaagagaacaccaatgggccacgcattattgcataatatcgatagacacggacaatacaactgcattttcttgtgtgtactggacagagtaaagtctcaggctcagctcacttttctgttgcctctttaatcttttcaaattgactttgaaacagagacacgaaatggggattgatttagttgcacgaactatttactgatgctgactctcgtttaccatttttcaacctcactgctttactgtaggagaacaccaagactggtctcaagttacccatatacgtcaagaacatccacaaaggcaagcatggaagcgattcaggcgtgtatgatgcgaatggaaggtacctttctatattattatgtttttaagctgaaggtaccttaatttctttatgtgtcagcatcagtatgaacatgactcatgcggccagcacagatgtcagatgtttaattgggcttaatcgctttgtcgttgtactttactcatcaagattaggataaattaagccagcacctaaccataaagtaacacagacgcggatgaattgcttaacaaacaggagaactgaatcgcctttttcatgtggcatggtgatgcagagatttgagggatatcacccggccaaaaagatttgagagatatctgtttattaggcactttagttgtctgttccttctgtcaaaagctagtgaagatgcatccaaactatagttctaagagagatcacgcataatatgaaatcaaagatatggttgtttcattttctttagaacacttggttgttccattgcatgcatagtttaatacgtgtgaaatgcacatggtgaaaaaaatattgccactaagactcatggtatcacattgagatctataagcttttaggatcactatgcagtgaggctatcactgctgttgttttcttattgtttttgtttcaatgcgaacaaacaaaggcacttgtcttagctagagtcgtaaaaataatgcaatagggtaacatggatctagatttgctaaccacacaatatgtacacttgcaggtttgtcccagaaaagttcgaggaaatattcaagaagcatgctcacaccaggcctgatgccctaacagacaaagagctgaaggagttgctccaatcaaacagggagcctaaagatttcaaaggatggtgagttctcatctagattaagactgtaagaacaatggtaaaatgaagttatgttttgtccatgctcatccttttttttctttgggggaaaacgttgcaggttgggtggcttcacagagtggaaagtattgtactacctctgcaaagacaaggatggatttcttcacaaggatactgtcagggcagtctatgatggaagcctatttgcaaagatggagcaagagaagcagtctgctaagaagaaatgataagaccatactgggtgctgtaattatctgttattgttgcaggtgattgtaaattacggtgtgggtgtgaatccaaaattattgctgtagtttgattgcgcgtgtttgttgacccgttcctgtaacaagaagctatttgtgaagttattggaagtgtttgtaaacatggtggtatcctctgatttattcacttcatttttttctttt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0254700, RefSeq:Os06g0254700