Difference between revisions of "Os03g0183000"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(References)
Line 18: Line 18:
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">
 +
Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:04, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others. In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.

Expression

The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).

Evolution

In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.

Labs working on this gene

Research Center for Molecular & Developmental Biology, Key Laboratory of Photosynthesis & Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China

References

<references> <ref name="ref1"> Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61

Structured Information

Gene Name

Os03g0183000

Description

Similar to AP2 domain containing protein RAP2.6 (Fragment)

Version

NM_001055712.1 GI:115451152 GeneID:4331845

Length

1794 bp

Definition

Oryza sativa Japonica Group Os03g0183000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:4327072..4328865

Sequence Coding Region

4327660..4328399,4328509..4328773

Expression

GEO Profiles:Os03g0183000

Genome Context

<gbrowseImage1> name=NC_008396:4327072..4328865 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:4327072..4328865 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga</cdnaseq>

Protein Sequence

<aaseq>MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF </aaseq>

Gene Sequence

<dnaseqindica>467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0183000, RefSeq:Os03g0183000