|
|
| Line 18: |
Line 18: |
| | | | |
| | ==References== | | ==References== |
| − | <references>
| |
| − | <ref name="ref1">
| |
| | Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61 | | Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61 |
| − |
| |
| − | ==Structured Information==
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0183000|
| |
| − | Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|
| |
| − | Version = NM_001055712.1 GI:115451152 GeneID:4331845|
| |
| − | Length = 1794 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:4327072..4328865|
| |
| − | CDS = 4327660..4328399,4328509..4328773|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:4327072..4328865
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:4327072..4328865
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga</cdnaseq>|
| |
| − | AA = <aaseq>MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF </aaseq>|
| |
| − | DNA = <dnaseqindica>467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|
| |
| − | }}
| |
| − | [[Category:Genes]]
| |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]]
| |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 3]]
| |
| − | [[Category:Chromosome 3]]
| |
Revision as of 07:05, 9 June 2014
Please input one-sentence summary here.
Annotated Information
Function
AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.
In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP
domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF
accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.
Expression
The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).
Evolution
In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.
Labs working on this gene
Research Center for Molecular & Developmental Biology, Key Laboratory of Photosynthesis & Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China
References
Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61