Difference between revisions of "Os08g0140300"
| Line 1: | Line 1: | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
| − | + | L-Tryptophan decarboxylase (TDC) belong to a family of aromatic | |
| + | L-amino acid decarboxylases and convert tryptophan to | ||
| + | tryptamine, which could be converted to serotonin by a | ||
| + | constitutively expressed tryptamine 5' | ||
| + | hydroxylase (T5H). | ||
| + | in rice plants. | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
| + | transgenic plants that produced TDC showed a | ||
| + | normal phenotype and contained 25-fold and 11-fold higher | ||
| + | serotonin in the leaves and seeds, respectively, than the | ||
| + | wild-type plants. | ||
| + | |||
| + | 1.over-expression of TDC results in stunted | ||
| + | growth, low fertility and the accumulation of serotonin, | ||
| + | which when converted to serotonin dimer, leads to a dark | ||
| + | brown plant color. | ||
| + | [[File:Example.jpg]] | ||
| + | |||
| + | |||
| + | |||
| + | 2.TDC plays a rate-limiting role for serotonin accumulation,and serotonin was abundant in the vascular parenchyma cells, including companion cells and xylem-parenchyma cells, suggestive of its involvement in maintaining the cellular integrity of these cells for facilitating efficient | ||
| + | nutrient recycling from senescing leaves to sink tissues during senescence. | ||
===Expression=== | ===Expression=== | ||
| Line 18: | Line 38: | ||
==References== | ==References== | ||
Please input cited references here. | Please input cited references here. | ||
| − | + | 1. Parawee Kanjanaphachoat;Bi-Yin Wei;Shuen-Fang Lo;I-Wen Wang;Chang-Sheng Wang;Su-May Yu;Ming-Liang Yen;Sheng-Hsien Chiu;Chien-Chen Lai;Liang-Jwu Chen | |
| + | Serotonin accumulation in transgenic rice by over-expressing tryptophan decarboxlyase results in a dark brown phenotype and stunted growth | ||
| + | Plant Molecular Biology, 2012, 78(6): 525-543 | ||
| + | 2. Kiyoon Kang;Young-Soon Kim;Sangkyu Park;Kyoungwhan Back | ||
| + | Senescence-Induced Serotonin Biosynthesis and Its Role in Delaying Senescence in Rice Leaves | ||
| + | Plant Physiology, 2009, 150(3): 1380-1393 | ||
| + | 3. Sei Kang;Kiyoon Kang;Kyungjin Lee;Kyoungwhan Back | ||
| + | Characterization of rice tryptophan decarboxylases and their direct involvement in serotonin biosynthesis in transgenic rice | ||
| + | Planta, 2007, 227(1): 263-272 | ||
==Structured Information== | ==Structured Information== | ||
{{JaponicaGene| | {{JaponicaGene| | ||
Revision as of 07:35, 9 June 2014
Please input one-sentence summary here. L-Tryptophan decarboxylase (TDC) belong to a family of aromatic L-amino acid decarboxylases and convert tryptophan to tryptamine, which could be converted to serotonin by a constitutively expressed tryptamine 5' hydroxylase (T5H). in rice plants.
Contents
Annotated Information
Function
Please input function information here. transgenic plants that produced TDC showed a normal phenotype and contained 25-fold and 11-fold higher serotonin in the leaves and seeds, respectively, than the wild-type plants.
1.over-expression of TDC results in stunted
growth, low fertility and the accumulation of serotonin,
which when converted to serotonin dimer, leads to a dark
brown plant color.
2.TDC plays a rate-limiting role for serotonin accumulation,and serotonin was abundant in the vascular parenchyma cells, including companion cells and xylem-parenchyma cells, suggestive of its involvement in maintaining the cellular integrity of these cells for facilitating efficient nutrient recycling from senescing leaves to sink tissues during senescence.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here. 1. Parawee Kanjanaphachoat;Bi-Yin Wei;Shuen-Fang Lo;I-Wen Wang;Chang-Sheng Wang;Su-May Yu;Ming-Liang Yen;Sheng-Hsien Chiu;Chien-Chen Lai;Liang-Jwu Chen
Serotonin accumulation in transgenic rice by over-expressing tryptophan decarboxlyase results in a dark brown phenotype and stunted growth Plant Molecular Biology, 2012, 78(6): 525-543
2. Kiyoon Kang;Young-Soon Kim;Sangkyu Park;Kyoungwhan Back
Senescence-Induced Serotonin Biosynthesis and Its Role in Delaying Senescence in Rice Leaves Plant Physiology, 2009, 150(3): 1380-1393
3. Sei Kang;Kiyoon Kang;Kyungjin Lee;Kyoungwhan Back
Characterization of rice tryptophan decarboxylases and their direct involvement in serotonin biosynthesis in transgenic rice Planta, 2007, 227(1): 263-272
Structured Information
| Gene Name |
Os08g0140300 |
|---|---|
| Description |
Similar to Tryptophan decarboxylase |
| Version |
NM_001067503.1 GI:115474742 GeneID:4344636 |
| Length |
1866 bp |
| Definition |
Oryza sativa Japonica Group Os08g0140300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:2255010..2256875 |
| Sequence Coding Region |
2255141..2256685 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:2255010..2256875 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:2255010..2256875 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgggcagcttggacaccaaccccacggccttctccgccttccccgccggcgagggtgaaaccttccagccgctcaacgccgatgatgtccggtcctacctccacaaggcggtggacttcatctcggactactacaagtccgtggagtccatgccggtgctgcccaatgtcaagccggggtacctgcaggacgagctcagggcctcgccgccgacgtactcggcgccgttcgacgtcaccatgaaggagctccggagctccgtcgtccccgggatgacgcactgggcgagccccaacttcttcgcgtttttcccctccacgaatagtgcggccgccattgccggcgacctcatcgcgtcggcgatgaacacggtcgggttcacgtggcaggcgtcgccggcggccaccgagatggaggtgctcgcgctggactggctcgcgcagatgctcaacctgccgacgagcttcatgaaccgcaccggcgaggggcgtggcaccggcggtggggttattctggggacgaccagcgaggcgatgctcgtcacgctcgttgccgcgcgcgacgccgcgctgcggcggagcggcagcgacggcgtggcgggactccaccggctcgccgtgtacgccgccgaccagacgcactccacgttcttcaaggcgtgccgcctcgccgggtttgatccggcgaacatccggtcgatccccaccggggccgagaccgactacggcctcgacccggcgaggctgctggaggcgatgcaggccgacgccgacgccgggctggtgcccacctacgtgtgcgccacggtgggcaccacgtcgtccaacgccgtcgacccggtgggcgccgtggccgacgtcgcggcgaggttcgccgcgtgggtgcacgtcgacgcggcgtacgccggcagcgcgtgcatctgcccggagttcaggcaccacctcgacggcgtggagcgcgtggactccatcagcatgagcccccacaaatggctgatgacctgcctcgactgcacctgcctctacgtgcgcgacacccaccgcctcaccggctccctcgagaccaacccggagtacctcaagaaccacgccagcgactccggcgaggtcaccgacctcaaggacatgcaggtcggcgtcggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgtcgccaagctgcaggagcacatccggagcgacgtcgccatggccaaggtgttcgaggacctcgtccgcggcgacgacaggttcgaggtcgtcgtgccgaggaacttcgctctcgtctgcttcaggatcagggccggcgccggcgccgccgccgcgacggaggaggacgccgacgaggcgaaccgcgagctgatggagcggctgaacaagaccggcaaggcgtacgtggcgcacacggtggtcggcggcaggttcgtgctgcgcttcgcggtgggctcgtcgctgcaggaagagcatcacgtgcggagcgcgtgggagctcatcaagaagacgaccaccgagatgatgaactaa</cdnaseq> |
| Protein Sequence |
<aaseq>MGSLDTNPTAFSAFPAGEGETFQPLNADDVRSYLHKAVDFISDY YKSVESMPVLPNVKPGYLQDELRASPPTYSAPFDVTMKELRSSVVPGMTHWASPNFFA FFPSTNSAAAIAGDLIASAMNTVGFTWQASPAATEMEVLALDWLAQMLNLPTSFMNRT GEGRGTGGGVILGTTSEAMLVTLVAARDAALRRSGSDGVAGLHRLAVYAADQTHSTFF KACRLAGFDPANIRSIPTGAETDYGLDPARLLEAMQADADAGLVPTYVCATVGTTSSN AVDPVGAVADVAARFAAWVHVDAAYAGSACICPEFRHHLDGVERVDSISMSPHKWLMT CLDCTCLYVRDTHRLTGSLETNPEYLKNHASDSGEVTDLKDMQVGVGRRFRGLKLWMV MRTYGVAKLQEHIRSDVAMAKVFEDLVRGDDRFEVVVPRNFALVCFRIRAGAGAAAAT EEDADEANRELMERLNKTGKAYVAHTVVGGRFVLRFAVGSSLQEEHHVRSAWELIKKT TTEMMN</aaseq> |
| Gene Sequence |
<dnaseqindica>132..1676#aaaccaacacaccaacctagctaactcactcactcactccttcttcttgcgacctagctatcgagctagagcttccaaaaccctagctagctagctgagacagttagtttcatctcgaactagttgttgatatgggcagcttggacaccaaccccacggccttctccgccttccccgccggcgagggtgaaaccttccagccgctcaacgccgatgatgtccggtcctacctccacaaggcggtggacttcatctcggactactacaagtccgtggagtccatgccggtgctgcccaatgtcaagccggggtacctgcaggacgagctcagggcctcgccgccgacgtactcggcgccgttcgacgtcaccatgaaggagctccggagctccgtcgtccccgggatgacgcactgggcgagccccaacttcttcgcgtttttcccctccacgaatagtgcggccgccattgccggcgacctcatcgcgtcggcgatgaacacggtcgggttcacgtggcaggcgtcgccggcggccaccgagatggaggtgctcgcgctggactggctcgcgcagatgctcaacctgccgacgagcttcatgaaccgcaccggcgaggggcgtggcaccggcggtggggttattctggggacgaccagcgaggcgatgctcgtcacgctcgttgccgcgcgcgacgccgcgctgcggcggagcggcagcgacggcgtggcgggactccaccggctcgccgtgtacgccgccgaccagacgcactccacgttcttcaaggcgtgccgcctcgccgggtttgatccggcgaacatccggtcgatccccaccggggccgagaccgactacggcctcgacccggcgaggctgctggaggcgatgcaggccgacgccgacgccgggctggtgcccacctacgtgtgcgccacggtgggcaccacgtcgtccaacgccgtcgacccggtgggcgccgtggccgacgtcgcggcgaggttcgccgcgtgggtgcacgtcgacgcggcgtacgccggcagcgcgtgcatctgcccggagttcaggcaccacctcgacggcgtggagcgcgtggactccatcagcatgagcccccacaaatggctgatgacctgcctcgactgcacctgcctctacgtgcgcgacacccaccgcctcaccggctccctcgagaccaacccggagtacctcaagaaccacgccagcgactccggcgaggtcaccgacctcaaggacatgcaggtcggcgtcggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgtcgccaagctgcaggagcacatccggagcgacgtcgccatggccaaggtgttcgaggacctcgtccgcggcgacgacaggttcgaggtcgtcgtgccgaggaacttcgctctcgtctgcttcaggatcagggccggcgccggcgccgccgccgcgacggaggaggacgccgacgaggcgaaccgcgagctgatggagcggctgaacaagaccggcaaggcgtacgtggcgcacacggtggtcggcggcaggttcgtgctgcgcttcgcggtgggctcgtcgctgcaggaagagcatcacgtgcggagcgcgtgggagctcatcaagaagacgaccaccgagatgatgaactaagtaaagagaagattacaaataaatacacatatttagaacacatatacgtttttgatttttttttttggggttttagatgcgaatctgttgattcattttgtgagctatttatacctatggatatatggatcaaaataaattattatttggttgtaatttttttaaaagatgaactgatactataccttac</dnaseqindica> |
| External Link(s) |