Difference between revisions of "Os10g0496900"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 21: Line 21:
  
 
==References==
 
==References==
<references>
+
 
 
<ref name="ref1">'''Yasuhito Sakuraba;Md Lutfor Rahman;Sung-Hwan Cho;Ye-Sol Kim;Hee-Jong Koh;Soo-Cheul Yoo;Nam-Chon Paek'''
 
<ref name="ref1">'''Yasuhito Sakuraba;Md Lutfor Rahman;Sung-Hwan Cho;Ye-Sol Kim;Hee-Jong Koh;Soo-Cheul Yoo;Nam-Chon Paek'''
 
   The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions
 
   The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions
Line 28: Line 28:
 
   NOA1 Functions in a Temperature-Dependent Manner to Regulate Chlorophyll Biosynthesis and Rubisco Formation in Rice
 
   NOA1 Functions in a Temperature-Dependent Manner to Regulate Chlorophyll Biosynthesis and Rubisco Formation in Rice
 
   PLoS ONE, 2011, 6(5): e20015</ref>
 
   PLoS ONE, 2011, 6(5): e20015</ref>
</references>
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 08:09, 9 June 2014

The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions.

Annotated Information

Function

OsPORB is essential for maintaining light-dependent Chl synthesis throughout leaf development, especially under HL conditions. The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions. NADPH:protochlorophyllide oxidoreductase (POR) catalyzes photoreduction of protochlorophyllide (Pchlide) to chlorophyllide in chlorophyll (Chl) synthesis, and is required for prolamellar body (PLB) formation in etioplasts.

Rice faded green leaf (fgl) mutants develop yellow/white leaf variegation and necrotic lesions during leaf elongation in field-grown plants. Map-based cloning revealed that FGL encodes OsPORB, one of two rice POR isoforms. In fgl, etiolated seedlings contained smaller PLBs in etioplasts, and lower levels of total and photoactive Pchlide. Under constant or high light (HL) conditions, newly emerging green leaves rapidly turned yellow and formed lesions. Increased levels of non-photoactive Pchlide, which acts as a photosensitizer, may cause reactive oxygen accumulation and lesion formation.

fgl harbors a 1-bp deletion in the coding region of OsPORB, resulting in a frameshift mutation and premature translational termination. Based on the expression analysis of two OsPOR genes and phenotypic characterization of the fgl mutant, we proposed that OsPORB plays important roles in maintaining a threshold Chl level throughout leaf development, especially under HL field conditions.

Expression

OsPORB expression is regulated in a circadian rhythm in short-day conditions. OsPORA was expressed at high levels in developing leaves and decreased dramatically in fully mature leaves, whereas OsPORB expression was relatively constant throughout leaf development. However, OsPORB expression is rapidly upregulated by HL treatment.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Department of Plant Science, Plant Genomics and Breeding Institute, Research Institute for Agriculture and Life Sciences,Seoul National University, Seoul 151-921, Korea

References

[1] [2]

Structured Information

Gene Name

Os10g0496900

Description

Similar to NADPH:protochlorophyllide oxidoreductase porB (Fragment)

Version

NM_001071490.1 GI:115482723 GeneID:4349004

Length

3713 bp

Definition

Oryza sativa Japonica Group Os10g0496900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:19357502..19361214

Sequence Coding Region

19359252..19359591,19360224..19360750

Expression

GEO Profiles:Os10g0496900

Genome Context

<gbrowseImage1> name=NC_008403:19357502..19361214 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:19357502..19361214 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggtgccgcgacttcctcaaggcgtcgcgcgccgccaaggccgccggcatggagaagggcagctacaccatcgtccacctcgacctggcgtcgctcgacagcgtcaggcagttcgtcgccaacgtccggcggctggagatgcccgtcgacgtggtggtgtgcaacgccgccgtgtaccagcccaccgccaagcagccgagcttcaccgccgacggcttcgagatgagcgtcggcgtcaaccacctcgggcacttcctcctcgcccgcgagctcctcgccgacctcacctcctccgactacccctccaagcgcctcatcatcgtcggctccatcaccgggaacacgaacacgctggcggggaacgtgccgccgaaggcgaacctgggggacctccgggggctcgcctcgggcctcgacggcgtgtcgagctccgccatgatcgacggcggcgagttcgacggcgccaaggcctacaaggacagcaaggtgtgcaacatgctgacgatgcaggagttccaccgccggtaccacggcgagaccggggtgacgttcgcgtcgctctaccccgggtgcatcgccaccacgggcctcttccgggagcacgtcccgctgttccgcctcctcttcccgcccttccagaagtacatcaccaagggctacgtctccgaggaggaggccggcaagcggctggcccaggtcgtcagtgaccccagcctcaccaagtccggggtgtactggagctggaacaacaactcggcctcgttcgagaaccagctctccgaggaggcctccgatccggagaaggccaagaaggtctgggagctcagcgagaagctcgtcggcttggccgatcacgatcagtga</cdnaseq>

Protein Sequence

<aaseq>MGCRDFLKASRAAKAAGMEKGSYTIVHLDLASLDSVRQFVANVR RLEMPVDVVVCNAAVYQPTAKQPSFTADGFEMSVGVNHLGHFLLARELLADLTSSDYP SKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLASGLDGVSSSAMIDGGEFDGAKAYK DSKVCNMLTMQEFHRRYHGETGVTFASLYPGCIATTGLFREHVPLFRLLFPPFQKYIT KGYVSEEEAGKRLAQVVSDPSLTKSGVYWSWNNNSASFENQLSEEASDPEKAKKVWEL SEKLVGLADHDQ</aaseq>

Gene Sequence

<dnaseqindica>1751..2090#2723..3249#agcttagaaccccaaccccccaaagcctcactcacttcgctgcagaggaaaaaaaagagagaaaaatctccgatggctctccaggcggccaccaccacctccttcctcccctccgcgctctccgcccgcaaggaggtgagagctctaagctcggggattcagccatggaggcatttcagagttcagactagttcagagttttgcttcgtgttcatggcggcgattggttaaatggttttttttttgtttttgggttggtttttgggggtgtagggagcggtgaaggactcggcgttcttgggcgttcgtctcggcgacgggctcaagctggagaccagtgctctcggccttcgcaccaaggtagtaactgtaataatgttgttacagcactctgcttgctctgtgctgatgctctgtttgttagtgctaatattagtacttactactaactggcgagtagtacaagtaattggctagttcgttcagtgaattgccaggttttcgtttctagacttcacgattattagtttcagactttcagttatgttggaggagcttaccactgtggctctgtggtttgctctgtcagattaggagcacccgtggcgttgcaaatggttatgcctgtgtttggcattaatcaactggctaatgagattatatcatgatgattctctcatcgttttagctatgacaatgtcaggggcttgttttgttttcacaggtgtgcagctttgctaattgctagtaacatcagtgtgtgccgccattgttagtgcaaccaagtagcctttgtgtctggttaatttgcaacttcaggttgacatttggacttgctgagtgagtgtatctagcattgcaaactgatgtgaattttgacgaacttttagtgcaagattgcaaggtttgcttgatgtacttagaaatggtagttgctcacaactctgacagcgccacaaaaattgtattatacttgattagcctggcattttgacttcctattgatctggattttatgtcagtgttagtttgagtatatatagcattgcaaagtgatgcgaatttgggtaacttttagtgcaagattgcaaggtttacttgctgtacttagaaatagttgctcaaaactctgacatcgccacacccccaaaaaattgtactactacttaattagctttggcatttcaagttcatattgatgtggatcgatttcataaacttgattttactgcaagactgtcaagtttgctccctgtaatttcataaacttggttccgcatgtaaactagacgaatttattaagcctaattaatccatcattagtaaatatttattgtagcatcacattattaaatcatagcataattagattcaaaagatttgtctcacaatttacatataaactgtgcaattatttttttccccacatttaatattcttgcatgttcaaacatttgatgtgatgtttttggccaaaaaattttttatataaaaacaaaggcctagtttgttcatatatcttgacattgttgccacgaaaactgaaactctcctgcagagggtgagcacgtcgtcggtggccatccgcgcgcaggcgtcggcggcggtgtcgtccccgacggtgacgccggcgtcgccgtcgggcaagcagacgctgcgcaagggcacggcggtcatcaccggcgcgtcgtccgggcttggcctcgcgacggcgaaggcgctggcggagacgggcaggtggcacgtcgtcatggggtgccgcgacttcctcaaggcgtcgcgcgccgccaaggccgccggcatggagaagggcagctacaccatcgtccacctcgacctggcgtcgctcgacagcgtcaggcagttcgtcgccaacgtccggcggctggagatgcccgtcgacgtggtggtgtgcaacgccgccgtgtaccagcccaccgccaagcagccgagcttcaccgccgacggcttcgagatgagcgtcggcgtcaaccacctcgggcacttcctcctcgcccgcgagctcctcgccgacctcacctcctccgactacccctccaagcgcctcatcatcgtcggctccatcaccggtaatgacaacctttcttcctcaccagaattaggctgttgtgttctaatgtcaaagcttccaacttctactattttgtagttctccacgtacacaattactacaattactgaactgctaaaaattgcatgttttataaaaaaaattataggaagttgttgtgattaatccaatttttaagtttttctttttcatcgggaagattgaaagagaccttctgaatgtattaagaatgagaaaaagttacaagaaaaacataataggaagttgtcgaggatgatgcgcaccagcgtgtgcgttcaagaaccacgagctaaccacacaagcacaaacctctaaaagtgaaaacttcttcttagataatacttaattaatggattatttttctgtgcatggagggcacaaccttatactgctttctaaaatgggtatgataattatttgatagtataaacgaatgaatcaagtattacaaagtcgataagctgatttttttttaaaaaaaaactttataagtgcagttgtaacttttttttaaaaaaaatatcatatcatttgaaagcatatcggcaacattctattgtaacatgttactataagaacatcgttctaatttcgatacgatgaatgcagggaacacgaacacgctggcggggaacgtgccgccgaaggcgaacctgggggacctccgggggctcgcctcgggcctcgacggcgtgtcgagctccgccatgatcgacggcggcgagttcgacggcgccaaggcctacaaggacagcaaggtgtgcaacatgctgacgatgcaggagttccaccgccggtaccacggcgagaccggggtgacgttcgcgtcgctctaccccgggtgcatcgccaccacgggcctcttccgggagcacgtcccgctgttccgcctcctcttcccgcccttccagaagtacatcaccaagggctacgtctccgaggaggaggccggcaagcggctggcccaggtcgtcagtgaccccagcctcaccaagtccggggtgtactggagctggaacaacaactcggcctcgttcgagaaccagctctccgaggaggcctccgatccggagaaggccaagaaggtctgggagctcagcgagaagctcgtcggcttggccgatcacgatcagtgagtgagagtgatgtgctattgattttcgtctaggattttgctgtgctcttcttcttcttctcctctctaccaagaaagatcgatggaggagaatttgtaggacgcgtttctcacgaattacttagctgttaatgatcagcttgatgtgtacgatatgatggtgcagagtgaaagttgtgttgttcactggtggatcatgggatgggaatatgggattgttgtaagatgtaactcaagtgttttcttttttgggattacttttggtaataagagcttgggtgatcgaaaactacagatggtttttcttttaagttgtatgatctctgtagagtttttgagtaatttgtagttttgtaccctatcaaagatcatctctagctgcctctgagctctccaactctatatgtccatctctagtatatatgtcccatatttctgactgaaaattttcaagtcggttggttc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0496900, RefSeq:Os10g0496900

  1. Yasuhito Sakuraba;Md Lutfor Rahman;Sung-Hwan Cho;Ye-Sol Kim;Hee-Jong Koh;Soo-Cheul Yoo;Nam-Chon Paek The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions The Plant Journal, 2013, 74(1): 122-133
  2. Qiaosong Yang;Han He;Heying Li;Hua Tian;Jianjun Zhang;Liguang Zhai;Jiandong Chen;Hong Wu;Ganjun Yi;Zheng-Hui He;Xinxiang Peng NOA1 Functions in a Temperature-Dependent Manner to Regulate Chlorophyll Biosynthesis and Rubisco Formation in Rice PLoS ONE, 2011, 6(5): e20015