Difference between revisions of "Os01g0704100"

From RiceWiki
Jump to: navigation, search
m (Annotated Information)
m (Function)
Line 5: Line 5:
  
 
===Function===
 
===Function===
Please input function information here.
+
  When the rice in a low nitrate supply environment , OsNRT2.3 plays an important role in nitrate and long distance transport from root to shoot.
 +
  On the one hand, overexpression of OsNRT2.3 can not only improve the total dry matter's accumulation and translocation in the later stage, but also can significantly increase dry matter's translocation efficiency and contribution rate of transferred dry matter in rice. On the other hand, overexpression of OsNRT2.3 can not only increase the amount of nitrogen accumulation and nitrogen translocation amount, but also can significantly increase rice N translocation rate and nitrogen contribution rate in the later stage.
 +
  OsNRT2.3 gene silencing could inhibit N03- transport to the shoot from underground, which leads to the accumulation of NO3- in rice roots, and thus indirectly down regulated OsNRT2.1/2.2 expression, eventually lead to reduced nitrate uptake in rice roots from the environment.
  
 
===Expression===
 
===Expression===

Revision as of 09:22, 9 June 2014

Please input one-sentence summary here.

Annotated Information

 The gene name of High-affinity Nitrate Transporter is OsNRT2.3, it located on Chromosome 1.  

Function

  When the rice in a low nitrate supply environment , OsNRT2.3 plays an important role in nitrate and long distance transport from root to shoot.
  On the one hand, overexpression of OsNRT2.3 can not only improve the total dry matter's accumulation and translocation in the later stage, but also can significantly increase dry matter's translocation efficiency and contribution rate of transferred dry matter in rice. On the other hand, overexpression of OsNRT2.3 can not only increase the amount of nitrogen accumulation and nitrogen translocation amount, but also can significantly increase rice N translocation rate and nitrogen contribution rate in the later stage.
  OsNRT2.3 gene silencing could inhibit N03- transport to the shoot from underground, which leads to the accumulation of NO3- in rice roots, and thus indirectly down regulated OsNRT2.1/2.2 expression, eventually lead to reduced nitrate uptake in rice roots from the environment.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0704100

Description

Similar to Membrane transporter

Version

NM_001050538.1 GI:115439446 GeneID:4324249

Length

2087 bp

Definition

Oryza sativa Japonica Group Os01g0704100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:30944695..30946781

Sequence Coding Region

30944917..30945104,30945195..30946467

Expression

GEO Profiles:Os01g0704100

Genome Context

<gbrowseImage1> name=NC_008394:30944695..30946781 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:30944695..30946781 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggctaagccggtggcgatggaggtggagggggtcgaggcggcggggggcaagccgcggttcaggatgccggtggactccgacctcaaggcgacggagttctggctcttctccttcgcgaggccacacatggcctccttccacatggcgtggttctccttcttctgctgcttcgtgtccacgttcgccgtgttcgcgcgtctggccatgggcacggcgtgcgacctggtcgggcccaggctggcctccgcgtctctgatcctcctcaccacaccggcggtgtactgctcctccatcatccagtccccgtcggggtacctcctcgtgcgcttcttcacgggcatctcgctggcgtcgttcgtgtcggcgcagttctggatgagctccatgttctcggcccccaaagtggggctggccaacggcgtggccggcggctggggcaacctcggcggcggcgccgtccagctgctcatgccgctcgtgtacgaggccatccacaagatcggtagcacgccgttcacggcgtggcgcatcgccttcttcatcccgggcctgatgcagacgttctcggccatcgccgtgctggcgttcgggcaggacatgcccggcggcaactacgggaagctccacaagactggcgacatgcacaaggacagcttcggcaacgtgctgcgccacgccctcaccaactaccgcggctggatcctggcgctcacctacggctacagcttcggcgtcgagctcaccatcgacaacgtcgtgcaccagtacttctacgaccgcttcgacgtcaacctccagaccgccgggctcatcgccgccagcttcgggatggccaacatcatctcccgccccggcggcgggctactctccgactggctctccagccggtacggcatgcgcggcaggctgtgggggctgtggactgtgcagaccatcggcggcgtcctctgcgtggtgctcggaatcgtcgacttctccttcgccgcgtccgtcgccgtgatggtgctcttctccttcttcgtccaggccgcgtgcgggctcaccttcggcatcgtgccgttcgtgtcgcggaggtcgctggggctcatctccgggatgaccggcggcgggggcaacgtgggcgccgtgctgacgcagtacatcttcttccacggcacaaagtacaagacggagaccgggatcaagtacatggggctcatgatcatcgcgtgcacgctgcccgtcatgctcatctacttcccgcagtggggcggcatgctcgtaggcccgaggaagggggccacggcggaggagtactacagccgggagtggtcggatcacgagcgcgagaagggtttcaacgcggccagcgtgcggttcgcggagaacagcgtgcgcgagggcgggaggtcgtcggcgaatggcggacagcccaggcacaccgtccccgtcgacgcgtcgccggccggggtgtga</cdnaseq>

Protein Sequence

<aaseq>MEAKPVAMEVEGVEAAGGKPRFRMPVDSDLKATEFWLFSFARPH MASFHMAWFSFFCCFVSTFAVFARLAMGTACDLVGPRLASASLILLTTPAVYCSSIIQ SPSGYLLVRFFTGISLASFVSAQFWMSSMFSAPKVGLANGVAGGWGNLGGGAVQLLMP LVYEAIHKIGSTPFTAWRIAFFIPGLMQTFSAIAVLAFGQDMPGGNYGKLHKTGDMHK DSFGNVLRHALTNYRGWILALTYGYSFGVELTIDNVVHQYFYDRFDVNLQTAGLIAAS FGMANIISRPGGGLLSDWLSSRYGMRGRLWGLWTVQTIGGVLCVVLGIVDFSFAASVA VMVLFSFFVQAACGLTFGIVPFVSRRSLGLISGMTGGGGNVGAVLTQYIFFHGTKYKT ETGIKYMGLMIIACTLPVMLIYFPQWGGMLVGPRKGATAEEYYSREWSDHEREKGFNA ASVRFAENSVREGGRSSANGGQPRHTVPVDASPAGV</aaseq>

Gene Sequence

<dnaseqindica>223..410#501..1773#agcgccggcctcccaccggtcgcgtaagatcacgcccgaaatctttattcattttctctccaccggttgccctctcgccgcacccaaccatcgcgccacgccgcgccgcgctgccggagccgcgctttccgctatgctataagagctgacgcgcagggcacagcggatgtacgtacacacagtcactagctaagctgctagccttgctaccacgtgttggagatggaggctaagccggtggcgatggaggtggagggggtcgaggcggcggggggcaagccgcggttcaggatgccggtggactccgacctcaaggcgacggagttctggctcttctccttcgcgaggccacacatggcctccttccacatggcgtggttctccttcttctgctgcttcgtgtccacgttcgccgcgccgccgctgctgccgctcatccgcgacaccctcgggctcacggccacggacatcggcaacgccgggatcgcgtccgtgtcgggcgccgtgttcgcgcgtctggccatgggcacggcgtgcgacctggtcgggcccaggctggcctccgcgtctctgatcctcctcaccacaccggcggtgtactgctcctccatcatccagtccccgtcggggtacctcctcgtgcgcttcttcacgggcatctcgctggcgtcgttcgtgtcggcgcagttctggatgagctccatgttctcggcccccaaagtggggctggccaacggcgtggccggcggctggggcaacctcggcggcggcgccgtccagctgctcatgccgctcgtgtacgaggccatccacaagatcggtagcacgccgttcacggcgtggcgcatcgccttcttcatcccgggcctgatgcagacgttctcggccatcgccgtgctggcgttcgggcaggacatgcccggcggcaactacgggaagctccacaagactggcgacatgcacaaggacagcttcggcaacgtgctgcgccacgccctcaccaactaccgcggctggatcctggcgctcacctacggctacagcttcggcgtcgagctcaccatcgacaacgtcgtgcaccagtacttctacgaccgcttcgacgtcaacctccagaccgccgggctcatcgccgccagcttcgggatggccaacatcatctcccgccccggcggcgggctactctccgactggctctccagccggtacggcatgcgcggcaggctgtgggggctgtggactgtgcagaccatcggcggcgtcctctgcgtggtgctcggaatcgtcgacttctccttcgccgcgtccgtcgccgtgatggtgctcttctccttcttcgtccaggccgcgtgcgggctcaccttcggcatcgtgccgttcgtgtcgcggaggtcgctggggctcatctccgggatgaccggcggcgggggcaacgtgggcgccgtgctgacgcagtacatcttcttccacggcacaaagtacaagacggagaccgggatcaagtacatggggctcatgatcatcgcgtgcacgctgcccgtcatgctcatctacttcccgcagtggggcggcatgctcgtaggcccgaggaagggggccacggcggaggagtactacagccgggagtggtcggatcacgagcgcgagaagggtttcaacgcggccagcgtgcggttcgcggagaacagcgtgcgcgagggcgggaggtcgtcggcgaatggcggacagcccaggcacaccgtccccgtcgacgcgtcgccggccggggtgtgaagaatgccacggacaataaggtcgcggttgtagtacaactgtacaaattgatggtacgtgtcgtttgaccgcgcgcgcgcacagtgtgggtcgtggcctcgtgggcttagtggagtacagtgaggggtgtacgtgtgtcgtggcgcgcgcggtcacctcggtggccttgggattgggggggcactatacgctagtactccagatatatacgggtttgatttacttctgtggatcggcgcttgttggtggtttgctccctgtggtttttgtgatggtaatcatactcatactcaaacagtcaaaactttttgatg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0704100, RefSeq:Os01g0704100