Difference between revisions of "Os08g0237000"

From RiceWiki
Jump to: navigation, search
(References)
(References)
 
(20 intermediate revisions by the same user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Xyloglucan endotransglucosylases/hydrolases (XTHs) that mediate cleavage and rejoining of the β (1-4)-xyloglucans of the primary cell wall are considered to play an important role in the construction and restructuring of xyloglucan cross-links.OsXTH8 was a single copy gene; its full-length cDNA was 1,298 bp encoding a predicted protein of 290 amino acids.OsXTH8 may play cooperative role with OsXTR1, OsXTR2, OsXTR3, OsXTR4 genes and others that are expressed in overlapping regions. OsXTH8 is involved in cell wall modification processes during rice growth and development.OsXTH8 acts to alter the structure of cell wall in response to gibberellic acid.
+
Xyloglucan endotransglucosylases/hydrolases (XTHs) that mediate cleavage and rejoining of the β (1-4)-xyloglucans of the primary cell wall are considered to play an important role in the construction and restructuring of xyloglucan cross-links.OsXTH8 was a single copy gene; its full-length cDNA was 1,298 bp encoding a predicted protein of 290 amino acids.OsXTH8 may play cooperative role with OsXTR1, OsXTR2, OsXTR3, OsXTR4 genes and others that are expressed in overlapping regions. OsXTH8 is involved in cell wall modification processes during rice growth and development.OsXTH8 acts to alter the structure of cell wall in response to gibberellic acid<ref name="ref1"/>.
 +
.
  
 
===Expression===
 
===Expression===
OsXTH8 was preferentially expressed in rice leaf sheath in response to gibberellic acid. OsXTH8 was highly expressed in vascular bundles of leaf sheath and young nodal roots where the cells are actively undergoing elongation and differentiation. OsXTH8 gene expression was up-regulated by gibberellic acid and there was very little effect of other hormones. Reduced accumulation of active GA was accompanied by preferential suppression of OsXTH8 expression, and OsXTH8 expression increased when exogenous GA3 was applied to the semidwarf mutant. In two genetic mutants of rice with abnormal height, the expression of OsXTH8 positively correlated with the height of the mutants. Transgenic rice expressing an RNAi construct of OsXTH8 exhibited repressed growth. These results indicate that OsXTH8 is differentially expressed in rice leaf sheath in relation to gibberellin and potentially involved in cell elongation processes.
+
OsXTH8 was preferentially expressed in rice leaf sheath in response to gibberellic acid. OsXTH8 was highly expressed in vascular bundles of leaf sheath and young nodal roots where the cells are actively undergoing elongation and differentiation. OsXTH8 gene expression was up-regulated by gibberellic acid and there was very little effect of other hormones.Reduced accumulation of active GA was accompanied by preferential suppression of OsXTH8 expression, and OsXTH8 expression increased when exogenous GA3 was applied to the semidwarf mutant. In two genetic mutants of rice with abnormal height, the expression of OsXTH8 positively correlated with the height of the mutants. Transgenic rice expressing an RNAi construct of OsXTH8 exhibited repressed growth. These results indicate that OsXTH8 is differentially expressed in rice leaf sheath in relation to gibberellin and potentially involved in cell elongation processes.
  
OsXTH8 was expressed in growing regions such as shoot apical meristem, vascular bundles of leaf sheath, and young crown roots developing from nodes; thus, OsXTH8 exhibited a unique expression pattern in terms of organ and stage specificity during leaf sheath elongation and young nodal root development. The expression of OsXTH8 in the shoot apex meristem, vascular bundles in leaf sheath, and youngnodal roots supports its role in cell wall modification processes during active growth.
+
OsXTH8 was expressed in growing regions such as shoot apical meristem, vascular bundles of leaf sheath, and young crown roots developing from nodes; thus, OsXTH8 exhibited a unique expression pattern in terms of organ and stage specificity during leaf sheath elongation and young nodal root development. The expression of OsXTH8 in the shoot apex meristem, vascular bundles in leaf sheath, and youngnodal roots supports its role in cell wall modification processes during active growth<ref name="ref1"/>.
  
  
 
[[File:RICE1.jpg|caption]]
 
[[File:RICE1.jpg|caption]]
 +
 +
'''Alternative Organ- and Cell Type-Expression Profiles of OsXTH8'''
 +
 +
It has been shown that different members of XTH gene family are specifically regulated by various physiological and environmental stimuli<ref name="ref2"/>.To examine the tissue specificity of OsXTH8, total RNAs from rice callus, root, leaf blade, and leaf sheath were hybridized with OsXTH8-specific DNA probe. A strong signal was detected in leaf sheaths but weak or no signal was observed in leaf blades, roots, and calli (Fig. 4A). These expressions were enhanced by GA3 treatment (Fig. 4A). When 1-month-old seedlings were used to characterize the expression in leaf sheath, the expression was mainly found in the three basal parts of leaf sheath (Fig. 4B). Enhanced expression of OsXTH8 in the third part of 1-month-old rice seedling, which corresponded to the second internode of leaf sheath, compared to two basal parts of leaf sheath showed that OsXTH8 is differentially expressed in leaf sheath<ref name="ref1"/>.
 +
 +
[[File:dami3.jpg|caption]] 
 +
[[File:dami4.jpg|caption]]
 +
[[File:dami5.jpg|caption]]
  
 
===Evolution===
 
===Evolution===
The analysis revealed that XTHs could be loosely grouped into four distinct groups (Fig. 3). Group 1 contains genes that share a high level of sequence identity among different species and that are expressed in young developing tissues. Group 2 comprises ''XTH'' genes from several species showing diverse patterns of expression and response to hormonal or mechanical stimuli, including touchinducible, flooding-response, BR-inducible, and fruit ripening-related ''XTHs''. Group 3 represents a divergent group of ''XTHs'', including ''NXG1'' from nasturtium (''Tropaeolum'' ''majus'') that can act as xyloglucan hydrolase and transglycosylase. OsXTH8 has the highest homology to sequences in Group 4, consisting of well-characterized barley (''Hordeum vulgare'') genes, ''HvPM2'' and ''HvPM5'',which are up-regulated by GA in barley leaf sheaths and leaves. Monocot members of group 4 revealed to have two substitutions (DEIDIEFMG) compared to the consensus sequence (DEIDFEFLG). The presence of different amino acid residues in the putative catalytic region may attribute to unique enzymatic activity of OsXTH8.  
+
The analysis revealed that XTHs could be loosely grouped into four distinct groups (Fig. 3). Group 1 contains genes that share a high level of sequence identity among different species and that are expressed in young developing tissues<ref name="ref3"/><ref name="ref4"/><ref name="ref5"/>. Group 2 comprises ''XTH'' genes from several species showing diverse patterns of expression and response to hormonal or mechanical stimuli, including touchinducible, flooding-response, BR-inducible, and fruit ripening-related ''XTHs''<ref name="ref6"/>. Group 3 represents a divergent group of ''XTHs'', including ''NXG1'' from nasturtium (''Tropaeolum'' ''majus'') that can act as xyloglucan hydrolase and transglycosylase<ref name="ref7"/>. OsXTH8 has the highest homology to sequences in Group 4, consisting of well-characterized barley (''Hordeum vulgare'') genes, ''HvPM2'' and ''HvPM5'',which are up-regulated by GA in barley leaf sheaths and leaves<ref name="ref8"/>. Monocot members of group 4 revealed to have two substitutions (DEIDIEFMG) compared to the consensus sequence (DEIDFEFLG). The presence of different amino acid residues in the putative catalytic region may attribute to unique enzymatic activity of OsXTH8.  
  
 
[[File:rice 2.jpg|caption]]
 
[[File:rice 2.jpg|caption]]
Line 28: Line 37:
  
 
==References==
 
==References==
[1] Jan A, Yang G, Nakamura H, et al. Characterization of a xyloglucan endotransglucosylase gene that is up-regulated by gibberellin in rice [J]. Plant physiology, 2004, 136(3): 3670-3681.
+
<references>
  
[2]Tanaka T, Antonio B A, Kikuchi S, et al. The rice annotation project database (RAP-DB): 2008 update[J]. Nucleic acids research, 2008, 36(Sup 1): D1028-D1033.
+
<ref name="ref1">Jan A, Yang G, Nakamura H, et al. Characterization of a xyloglucan endotransglucosylase gene that is up-regulated by gibberellin in rice [J]. Plant physiology, 2004, 136(3): 3670-3681.</ref>
  
[3]Rice Annotation Project, et al. Curated genome annotation of ''Oryza sativa'' ssp. ''japonica'' and comparative genome analysis with ''Arabidopsis thaliana.'' Genome Res, 2007, 17: 175-183.  
+
<ref name="ref2">Xu W, Campbell P, Vargheese AK, Braam J. The Arabidopsis XET-related gene family: environmental and hormonal regulation of expression. Plant J. 1996 Jun; 9(6):879-89.</ref>
  
[4] Ohyanagi H, et al. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Nucleic Acids Research, 2006, 34: D741-D744.
+
<ref name="ref3">Catalá C, Rose JK, Bennett AB .Auxin regulation and spatial localization of an endo-1,4-beta-D-glucanase and a xyloglucan endotransglycosylase in expanding tomato hypocotyls.Plant J. 1997 Aug; 12(2):417-26.</ref>
 +
 +
<ref name="ref4">Shimizu Y, Aotsuka S, Hasegawa O, Kawada T, Sakuno T, Sakai F, Hayashi T. Changes in levels of mRNAs for cell wall-related enzymes in growing cotton fiber cells. Plant Cell Physiol. 1997 Mar; 38(3):375-8.</ref>
  
[5] International Rice Genome Sequencing Project. The map-based sequence of the rice genome. Nature, 2005,436(11): 793-800.
+
<ref name="ref5">Takano M, Fujii N, Higashitani A, Nishitani K, Hirasawa T, Takahashi H. Endoxyloglucan transferase cDNA isolated from pea roots and its fluctuating expression in hydrotropically responding roots. Plant Cell Physiol. 1999 Feb; 40(2):135-42.</ref>
  
[6] Asad Jan and Setsuko Komatsu. Functional Characterization of Gibberellin-Regulated Genes in Rice Using Microarray System. Geno. Prot. Bioinfo. 2006,4(3): 137-144.
+
<ref name="ref6">Catalá C, Rose JK, York WS, Albersheim P, Darvill AG, Bennett AB. Characterization of a tomato xyloglucan endotransglycosylase gene that is down-regulated by auxin in etiolated hypocotyls. Plant Physiol. 2001 Nov; 127(3):1180-92.</ref>
 
 
[7] Guangxiao Yang and Setsuko Komatsu. Microarray and Proteomic Analysis of Brassinosteroid- and Gibberellin-Regulated Gene and Protein Expression in Rice. Geno. Prot. Bioinfo. 2004,2(2): 77-83.
 
 
 
[8] Asad Jan,Hidemi Kitano,Hiroshi Matsumoto,Setsuko Komatsu. The rice OsGAE1 is a novel gibberellin-regulated gene and involved in rice growth[J]. Plant Molecular Biology . 2006 (3).
 
 
 
[9] Hironori Itoh,Tomoko Tatsumi,Tomoaki Sakamoto,Kazuko Otomo,Tomonobu Toyomasu,Hidemi Kitano,Motoyuki Ashikari,Shigeyuki Ichihara,Makoto Matsuoka.  A Rice Semi-Dwarf Gene, Tan-Ginbozu (D35), Encodes the Gibberellin Biosynthesis Enzyme, ent-Kaurene Oxidase[J]. Plant Molecular Biology . 2004 (4).
 
 
[10] Asaph Aharoni,Oscar Vorst.  DNA microarrays for functional plant genomics[J]. Plant Molecular Biology . 2002 (1-2).
 
 
[11] Asaph Aharoni,Oscar Vorst.  DNA microarrays for functional plant genomics[J]. Plant Molecular Biology . 2002 (1-2).
 
 
[12] G. V. Hoad.  Transport of hormones in the phloem of higher plants[J]. Plant Growth Regulation . 1995 (2).
 
 
[13] Richard Hooley. Gibberellins: perception, transduction and responses[J]. Plant Molecular Biology . 1994 (5).
 
  
[14]赵运军, 李来庚.植物细胞壁松弛因子.植物生理学报,2011, 47 (10): 925~935
+
<ref name="ref7">de Silva J, Jarman CD, Arrowsmith DA, Stronach MS, Chengappa S, Sidebottom C, Reid JS. Molecular characterization of a xyloglucan-specific endo-(1--&gt;4)-beta-D-glucanase (xyloglucan endo-transglycosylase) from nasturtium seeds. Plant J. 1993 May; 3(5):701-11.</ref>
  
 +
<ref name="ref8">Smith RC, Matthews PR, Schunmann PHD, Chandler PM(1996). The regulation of leaf elongation and xyloglucan endotransglucosylase by gibberellin in “Himalaya” barley (Hordeum vulgare L.). J Exp Bot 47: 1395–1404.</ref>
 
==Structured Information==
 
==Structured Information==
 
{{JaponicaGene|
 
{{JaponicaGene|

Latest revision as of 10:44, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Xyloglucan endotransglucosylases/hydrolases (XTHs) that mediate cleavage and rejoining of the β (1-4)-xyloglucans of the primary cell wall are considered to play an important role in the construction and restructuring of xyloglucan cross-links.OsXTH8 was a single copy gene; its full-length cDNA was 1,298 bp encoding a predicted protein of 290 amino acids.OsXTH8 may play cooperative role with OsXTR1, OsXTR2, OsXTR3, OsXTR4 genes and others that are expressed in overlapping regions. OsXTH8 is involved in cell wall modification processes during rice growth and development.OsXTH8 acts to alter the structure of cell wall in response to gibberellic acid[1]. .

Expression

OsXTH8 was preferentially expressed in rice leaf sheath in response to gibberellic acid. OsXTH8 was highly expressed in vascular bundles of leaf sheath and young nodal roots where the cells are actively undergoing elongation and differentiation. OsXTH8 gene expression was up-regulated by gibberellic acid and there was very little effect of other hormones.Reduced accumulation of active GA was accompanied by preferential suppression of OsXTH8 expression, and OsXTH8 expression increased when exogenous GA3 was applied to the semidwarf mutant. In two genetic mutants of rice with abnormal height, the expression of OsXTH8 positively correlated with the height of the mutants. Transgenic rice expressing an RNAi construct of OsXTH8 exhibited repressed growth. These results indicate that OsXTH8 is differentially expressed in rice leaf sheath in relation to gibberellin and potentially involved in cell elongation processes.

OsXTH8 was expressed in growing regions such as shoot apical meristem, vascular bundles of leaf sheath, and young crown roots developing from nodes; thus, OsXTH8 exhibited a unique expression pattern in terms of organ and stage specificity during leaf sheath elongation and young nodal root development. The expression of OsXTH8 in the shoot apex meristem, vascular bundles in leaf sheath, and youngnodal roots supports its role in cell wall modification processes during active growth[1].


caption

Alternative Organ- and Cell Type-Expression Profiles of OsXTH8

It has been shown that different members of XTH gene family are specifically regulated by various physiological and environmental stimuli[2].To examine the tissue specificity of OsXTH8, total RNAs from rice callus, root, leaf blade, and leaf sheath were hybridized with OsXTH8-specific DNA probe. A strong signal was detected in leaf sheaths but weak or no signal was observed in leaf blades, roots, and calli (Fig. 4A). These expressions were enhanced by GA3 treatment (Fig. 4A). When 1-month-old seedlings were used to characterize the expression in leaf sheath, the expression was mainly found in the three basal parts of leaf sheath (Fig. 4B). Enhanced expression of OsXTH8 in the third part of 1-month-old rice seedling, which corresponded to the second internode of leaf sheath, compared to two basal parts of leaf sheath showed that OsXTH8 is differentially expressed in leaf sheath[1].

caption caption caption

Evolution

The analysis revealed that XTHs could be loosely grouped into four distinct groups (Fig. 3). Group 1 contains genes that share a high level of sequence identity among different species and that are expressed in young developing tissues[3][4][5]. Group 2 comprises XTH genes from several species showing diverse patterns of expression and response to hormonal or mechanical stimuli, including touchinducible, flooding-response, BR-inducible, and fruit ripening-related XTHs[6]. Group 3 represents a divergent group of XTHs, including NXG1 from nasturtium (Tropaeolum majus) that can act as xyloglucan hydrolase and transglycosylase[7]. OsXTH8 has the highest homology to sequences in Group 4, consisting of well-characterized barley (Hordeum vulgare) genes, HvPM2 and HvPM5,which are up-regulated by GA in barley leaf sheaths and leaves[8]. Monocot members of group 4 revealed to have two substitutions (DEIDIEFMG) compared to the consensus sequence (DEIDFEFLG). The presence of different amino acid residues in the putative catalytic region may attribute to unique enzymatic activity of OsXTH8.

caption

Labs working on this gene

National Institute of Agrobiological Sciences, Tsukuba 305–8602, Japan (A.J., G.Y., H.N., H.I., S.K.);

University of Tsukuba, Tsukuba 305–8572, Japan (A.J., H.M.);

Nagoya University, Nagoya 464–8601, Japan (H.K., M.M.);

National Institute of Crop Science, Tsukuba 305-8518, Japan.

References

<references>

[1]

[2]

[3]

[4]

[5]

[6]

[7]

[8]

Structured Information

Gene Name

Os08g0237000

Description

Xyloglucan endotransglycosylase/hydrolase protein 8 precursor (EC 2.4.1.207) (End-xyloglucan transferase) (OsXTH8) (OsXRT5)

Version

NM_001067854.1 GI:115475444 GeneID:4345019

Length

1378 bp

Definition

Oryza sativa Japonica Group Os08g0237000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:8327025..8328402

Sequence Coding Region

8327064..8327545,8327644..8328034

Expression

GEO Profiles:Os08g0237000

Genome Context

<gbrowseImage1> name=NC_008401:8327025..8328402 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:8327025..8328402 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgaagcatctcgcgctgtccgtggccgccgcggtggccgtgtcgtggctggcggcgtcgtcggcggcggcggcggggttctacgagaagttcgacgtggtgggcgccggcgaccacgtgagggtggtgagcgacgacgggaagacgcagcaggtggcgctgacgctggaccggagctccgggtccgggttcacctccaaggacacctacctgttcggcgagttcagcgtccagatgaagctcgtcggcggcaactccgccggcaccgtcacctccttctacctctcctccggcgagggcgacggccacgacgagatcgacatcgagttcatgggcaacctcagcggcaacccctacgtcatgaacaccaacgtctgggctaatggcgacggcaagaaggagcaccagttctacctctggttcgaccccaccgccgacttccacacctacaagatcatctggaatccccaaaacatcatattccaggtggacgacgtgccggtgaggacgttcaagaagtacgacgacctggcgtacccgcagagcaagccgatgaggctgcacgcgacgctgtgggacggcagctactgggcgacgaggcacggcgacgtcaagatcgactggagcggcgcgccgttcgtggtgtcgtaccgcgggtacagcaccaacgcgtgcgtcaacaacaatcccgccggcgggtggtcgtcgtcgtggtgccccgagggcacgtcggcgtggatccaccgcgagctcgacggcgccgagctcggcaccgtcgcgtgggccgagcgcaactacatgtcctacaactactgcgccgacggctggcgcttcccccagggcttccccgccgagtgctaccgcaagtga</cdnaseq>

Protein Sequence

<aaseq>MAKHLALSVAAAVAVSWLAASSAAAAGFYEKFDVVGAGDHVRVV SDDGKTQQVALTLDRSSGSGFTSKDTYLFGEFSVQMKLVGGNSAGTVTSFYLSSGEGD GHDEIDIEFMGNLSGNPYVMNTNVWANGDGKKEHQFYLWFDPTADFHTYKIIWNPQNI IFQVDDVPVRTFKKYDDLAYPQSKPMRLHATLWDGSYWATRHGDVKIDWSGAPFVVSY RGYSTNACVNNNPAGGWSSSWCPEGTSAWIHRELDGAELGTVAWAERNYMSYNYCADG WRFPQGFPAECYRK</aaseq>

Gene Sequence

<dnaseqindica>40..521#620..1010#atccaccacccaaagacaaagcaagcaagtacagtagccatggcgaagcatctcgcgctgtccgtggccgccgcggtggccgtgtcgtggctggcggcgtcgtcggcggcggcggcggggttctacgagaagttcgacgtggtgggcgccggcgaccacgtgagggtggtgagcgacgacgggaagacgcagcaggtggcgctgacgctggaccggagctccgggtccgggttcacctccaaggacacctacctgttcggcgagttcagcgtccagatgaagctcgtcggcggcaactccgccggcaccgtcacctccttctacctctcctccggcgagggcgacggccacgacgagatcgacatcgagttcatgggcaacctcagcggcaacccctacgtcatgaacaccaacgtctgggctaatggcgacggcaagaaggagcaccagttctacctctggttcgaccccaccgccgacttccacacctacaagatcatctggaatccccaaaacatcatgtacgcatcacaaaaacgaactcaataatcctctcttcgtcaatcaaacaatcatcgtgttaatttgctgaattacgattacttccgctatgatacagattccaggtggacgacgtgccggtgaggacgttcaagaagtacgacgacctggcgtacccgcagagcaagccgatgaggctgcacgcgacgctgtgggacggcagctactgggcgacgaggcacggcgacgtcaagatcgactggagcggcgcgccgttcgtggtgtcgtaccgcgggtacagcaccaacgcgtgcgtcaacaacaatcccgccggcgggtggtcgtcgtcgtggtgccccgagggcacgtcggcgtggatccaccgcgagctcgacggcgccgagctcggcaccgtcgcgtgggccgagcgcaactacatgtcctacaactactgcgccgacggctggcgcttcccccagggcttccccgccgagtgctaccgcaagtgattttgaactcgatcgattcaaatcctcctccattgatgagttcttggcaatgatttgtaattgcttcttgttcttgttttcgtcttcgtcttcgtcttcttcttcttgatccatgtacattttgccatccattcgttctccatttgttacagttacagagacaggttgatggtgaattactattgccgccaatttttttcttcttcttgttactcgatccaattattactactagagttcatcttgcacagttgggcggtgtgaaaaactgaaaaagaaaagggtgtcaaatttgttgctgatgctgagcaagtgagcacatgcttatgctctcaggtatgaacaaaataaacagtaaaattatctgc</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0237000, RefSeq:Os08g0237000

  1. 1.0 1.1 1.2 1.3 Jan A, Yang G, Nakamura H, et al. Characterization of a xyloglucan endotransglucosylase gene that is up-regulated by gibberellin in rice [J]. Plant physiology, 2004, 136(3): 3670-3681.
  2. 2.0 2.1 Xu W, Campbell P, Vargheese AK, Braam J. The Arabidopsis XET-related gene family: environmental and hormonal regulation of expression. Plant J. 1996 Jun; 9(6):879-89.
  3. 3.0 3.1 Catalá C, Rose JK, Bennett AB .Auxin regulation and spatial localization of an endo-1,4-beta-D-glucanase and a xyloglucan endotransglycosylase in expanding tomato hypocotyls.Plant J. 1997 Aug; 12(2):417-26.
  4. 4.0 4.1 Shimizu Y, Aotsuka S, Hasegawa O, Kawada T, Sakuno T, Sakai F, Hayashi T. Changes in levels of mRNAs for cell wall-related enzymes in growing cotton fiber cells. Plant Cell Physiol. 1997 Mar; 38(3):375-8.
  5. 5.0 5.1 Takano M, Fujii N, Higashitani A, Nishitani K, Hirasawa T, Takahashi H. Endoxyloglucan transferase cDNA isolated from pea roots and its fluctuating expression in hydrotropically responding roots. Plant Cell Physiol. 1999 Feb; 40(2):135-42.
  6. 6.0 6.1 Catalá C, Rose JK, York WS, Albersheim P, Darvill AG, Bennett AB. Characterization of a tomato xyloglucan endotransglycosylase gene that is down-regulated by auxin in etiolated hypocotyls. Plant Physiol. 2001 Nov; 127(3):1180-92.
  7. 7.0 7.1 de Silva J, Jarman CD, Arrowsmith DA, Stronach MS, Chengappa S, Sidebottom C, Reid JS. Molecular characterization of a xyloglucan-specific endo-(1-->4)-beta-D-glucanase (xyloglucan endo-transglycosylase) from nasturtium seeds. Plant J. 1993 May; 3(5):701-11.
  8. 8.0 8.1 Smith RC, Matthews PR, Schunmann PHD, Chandler PM(1996). The regulation of leaf elongation and xyloglucan endotransglucosylase by gibberellin in “Himalaya” barley (Hordeum vulgare L.). J Exp Bot 47: 1395–1404.