Difference between revisions of "Os03g0854500"

From RiceWiki
Jump to: navigation, search
(References)
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
Heat stress transcription factor (Hsfs) is the thermal stress resistance of the center of the response regulator, at least 25 genes of Hsf indica and japonica genome. According to the structure OsHsfs proteins can be divided into three categories. Digital Northern analysis showed expression of a constitutively OsHsfs, most OsHsfs all tissues have low to moderate levels of expression, wherein, OsHsfA4a OsHsfA4d expression and ears, respectively advantages and adult leaves, while all OsHsfs in both ears and flower higher expression. OsHsfs expression of heat stress and oxidative stress response, and between members of different gene families are different, in the heat and hydrogen peroxide treatment, A class Hsfs than B, C categories have higher expression. OsHsfA1a, OsHsfA2b, OsHsfA3, OsHsfA7, OsHsfA9, OsHsfB2c, OsHsfC1b during thermal processing is upregulated and hydrogen peroxide, and OsHsfA2a, OsHsfA2c, OsHsfA2e, OsHsfA4a, OsHsfB2b, OsSHFC1b upregulated only in the heat treatment is identified in the promoter region of these OsHsfs some with stress-related cis-acting elements, however, the gene for heat stress response between these cis-elements and no significant correlation.
 
Heat stress transcription factor (Hsfs) is the thermal stress resistance of the center of the response regulator, at least 25 genes of Hsf indica and japonica genome. According to the structure OsHsfs proteins can be divided into three categories. Digital Northern analysis showed expression of a constitutively OsHsfs, most OsHsfs all tissues have low to moderate levels of expression, wherein, OsHsfA4a OsHsfA4d expression and ears, respectively advantages and adult leaves, while all OsHsfs in both ears and flower higher expression. OsHsfs expression of heat stress and oxidative stress response, and between members of different gene families are different, in the heat and hydrogen peroxide treatment, A class Hsfs than B, C categories have higher expression. OsHsfA1a, OsHsfA2b, OsHsfA3, OsHsfA7, OsHsfA9, OsHsfB2c, OsHsfC1b during thermal processing is upregulated and hydrogen peroxide, and OsHsfA2a, OsHsfA2c, OsHsfA2e, OsHsfA4a, OsHsfB2b, OsSHFC1b upregulated only in the heat treatment is identified in the promoter region of these OsHsfs some with stress-related cis-acting elements, however, the gene for heat stress response between these cis-elements and no significant correlation.
 +
 +
 +
OsHsfs a conserved DNA N terminal binding domain located near the DBD and hydrophobic residues HR-A / B, near the HR-A / B structure has a nuclear localization signal NLS. In addition OsHsfA7 and B, C are two types of small molecules Hsf, in all other OsHsfA a C-terminal leucine-rich nuclear export signal NES. Only OsHsfA with the C-terminal activation domain CTAD, which indicates that only OsHsfA can self activate. By protein sequence alignment, the distance HR-A and HR-B domain of domains between the ABC divided into three OsHsfs. Including 13 OsHsfAs, 8 个 OsHsfBs and 4 OsHsfCs
  
 
===Expression===
 
===Expression===

Revision as of 10:47, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Heat stress transcription factor (Hsfs) is the thermal stress resistance of the center of the response regulator, at least 25 genes of Hsf indica and japonica genome. According to the structure OsHsfs proteins can be divided into three categories. Digital Northern analysis showed expression of a constitutively OsHsfs, most OsHsfs all tissues have low to moderate levels of expression, wherein, OsHsfA4a OsHsfA4d expression and ears, respectively advantages and adult leaves, while all OsHsfs in both ears and flower higher expression. OsHsfs expression of heat stress and oxidative stress response, and between members of different gene families are different, in the heat and hydrogen peroxide treatment, A class Hsfs than B, C categories have higher expression. OsHsfA1a, OsHsfA2b, OsHsfA3, OsHsfA7, OsHsfA9, OsHsfB2c, OsHsfC1b during thermal processing is upregulated and hydrogen peroxide, and OsHsfA2a, OsHsfA2c, OsHsfA2e, OsHsfA4a, OsHsfB2b, OsSHFC1b upregulated only in the heat treatment is identified in the promoter region of these OsHsfs some with stress-related cis-acting elements, however, the gene for heat stress response between these cis-elements and no significant correlation.


OsHsfs a conserved DNA N terminal binding domain located near the DBD and hydrophobic residues HR-A / B, near the HR-A / B structure has a nuclear localization signal NLS. In addition OsHsfA7 and B, C are two types of small molecules Hsf, in all other OsHsfA a C-terminal leucine-rich nuclear export signal NES. Only OsHsfA with the C-terminal activation domain CTAD, which indicates that only OsHsfA can self activate. By protein sequence alignment, the distance HR-A and HR-B domain of domains between the ABC divided into three OsHsfs. Including 13 OsHsfAs, 8 个 OsHsfBs and 4 OsHsfCs

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Identification and expression analysis of OsHsfs in rice,Journal of Zhejiang University SCIENCE B, 2009, 10(4): 291-300

Structured Information

Gene Name

Os03g0854500

Description

Similar to Heat shock transcription factor 31 (Fragment)

Version

NM_001058473.1 GI:115456674 GeneID:4334826

Length

3436 bp

Definition

Oryza sativa Japonica Group Os03g0854500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:36839862..36843297

Sequence Coding Region

36839986..36840273,36841660..36842892

Expression

GEO Profiles:Os03g0854500

Genome Context

<gbrowseImage1> name=NC_008396:36839862..36843297 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:36839862..36843297 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggccgccgttgctgctgcggctgcggccgccggggcggtgacgacggcggtcgcgcctccgcccggcgcggcggtcagcaacggggtggcgaccgcgccgccgccgttcctgatgaagacgtacgagatggtggacgacccggccaccgatgccgtcgtctcatggggccccgggaacaacagcttcgttgtgtggaacacccccgagttcgcgcgcgacctcctccccaagtacttcaagcacagcaacttctcctccttcgtcaggcagctcaacacctacggatttaggaaagttgatccagataggtgggagtttgcaaacgaaggttttcttagaggacaaaagcatctactgaagaccatcaacagaaggaaaccaactcatggaaacaaccaagttcagcagcctcagttgccagctgctcctgtacctgcttgcgtagaagtggggaagtttgggatggaagaagagattgagatgctcaaaagggataaaaatgttttaatgcaggaacttgtcaggctgagacaacaacagcagacaacagatcatcagctgcagactttgggcaagcgtcttcaaggaatggagcaacggcaacaacaaatgatgtctttcctggctaaggcaatgcatagtcctggcttcctagcacaatttgtacagcaaaacgaaaacagcagaagaagaatagttgctagtaacaaaaagaggaggctaccaaagcaggatggttcgttggactctgaaagtgcttcattggatggacaaatagtaaaatatcaacctatgatcaatgaagcagccaaagcgatgctaaggaagatcctaaagctagattcttcacatagatttgaatccatgggcaattcagataatttccttcttgagaattatatgccaaatggtcaaggtcttgacagctcttcatcaactcggaattctggtgttacccttgcagaggtcccagctaactcaggtttgccatatgtagctacaagctctggactttcagctatttgttcaacttcgactcctcagattcagtgcccagttgttttggacaacggcatacccaaagaagttccaaacatgagtgcggtgccttctgttccgaaggctgtggctccaggcccaactgatatcaatattctggaattcccagatttgcaagatatagtagctgaagaaaatgttgatattcctggagggggctttgaaatgcctggtcctgagggtgtattctctttgcctgaagaaggtgatgatagtgttcccattgagactgatgagattttgtacaacgatgacacccagaaacttcctgctatcattgattctttctgggaacagttcctggtggctagccctctatctgttgataatgatgaagtcgattcaggtgtactagaccaaaaggaaacacaacaggggaatggatggaccaaagctgaaaacatggctaaccttacagaacagatgggcctcctgtcatcacaccatacaggatga</cdnaseq>

Protein Sequence

<aaseq>MEAAVAAAAAAAGAVTTAVAPPPGAAVSNGVATAPPPFLMKTYE MVDDPATDAVVSWGPGNNSFVVWNTPEFARDLLPKYFKHSNFSSFVRQLNTYGFRKVD PDRWEFANEGFLRGQKHLLKTINRRKPTHGNNQVQQPQLPAAPVPACVEVGKFGMEEE IEMLKRDKNVLMQELVRLRQQQQTTDHQLQTLGKRLQGMEQRQQQMMSFLAKAMHSPG FLAQFVQQNENSRRRIVASNKKRRLPKQDGSLDSESASLDGQIVKYQPMINEAAKAML RKILKLDSSHRFESMGNSDNFLLENYMPNGQGLDSSSSTRNSGVTLAEVPANSGLPYV ATSSGLSAICSTSTPQIQCPVVLDNGIPKEVPNMSAVPSVPKAVAPGPTDINILEFPD LQDIVAEENVDIPGGGFEMPGPEGVFSLPEEGDDSVPIETDEILYNDDTQKLPAIIDS FWEQFLVASPLSVDNDEVDSGVLDQKETQQGNGWTKAENMANLTEQMGLLSSHHTG</aaseq>

Gene Sequence

<dnaseqindica>125..412#1799..3031#aaattccccaccctcaaatccccccctacccacgggccccgatcccacgcctccccctaaccctacccatgctcacgctgtcgcgcccctgaccctcaccacgcctccccatacggatcgcctcatggaggccgccgttgctgctgcggctgcggccgccggggcggtgacgacggcggtcgcgcctccgcccggcgcggcggtcagcaacggggtggcgaccgcgccgccgccgttcctgatgaagacgtacgagatggtggacgacccggccaccgatgccgtcgtctcatggggccccgggaacaacagcttcgttgtgtggaacacccccgagttcgcgcgcgacctcctccccaagtacttcaagcacagcaacttctcctccttcgtcaggcagctcaacacctacgtacgtcccccccccccccccccccattcctctttcttcctactctactcaaaatacacaaggatccctccactattgctttagctgctttgggaagttatttcttacttcgcacaatccaccatcacgatacttactgctttcatttgctaccttcaatacttattggagactagttactccggattccattctttggtgacacacatatcgaccggctttaatactttccccttttggggcaccgtagatctggatgtcacctagggggattcataactctaatccagcacacttttagaccatctttaattctacagcacttgatacatcttatggttttgttaggccatcgtacctttattcatagttattcagtccaaaattttgaggtttcgtccccaaactacagcgtatatatttaatgagccaacatctatggcacttctgcagaggcttgactgtctctcttgaacaattacagtatgcacatcttaattcctcatgccttcttttaacaagaatgaaaaagttggtttttttgagtatgtacatcttacttgttcacgtcttctttaaacaagaatgaacaagttacacagagaacaaagcatcctcacgcgaagcaggtttaaatgctaaccgaaagctcatagtttcacgcacatatagatataggtattcttgttttgtcatcaattgtgcaactaccactgcttcaaaatcaccatctgtgatacctcctgtgaaggactgtctatttcaggtagacggtttttatgagatcgtttgtagtttgcacctttctgatgattgttgaaccagaagtaactacaccttaatggattaatgagcctatatgagatttgagtctgatcttttagaactttattaccaggcaagatagataactttcttcttgccgatataagtttttctcaagctgaattaacaaacacacggttgatatgtgcttttgcaactagcaatttattggtcctattcagttggctggggcctttatggcatttgcaaatatatctattacaccagtactgcttgtgcatcctgtggtagttttcttccctaatgtggccaatcagctgtttccttgtgaactacaaacagttttaagtgaatcatggacagtttgtactggttgtcttgtctgttttttctttggttcatcttttcttgatcctgctaatacactcagaatcacttaagccgaacagataaactgtgctatttacattagcccttctaatgatattactacttctgtaatcatataacactcagtcagaagtacttgtaccgggcagatacactgtgccatgtacgttagccggcctctaacgatctcattggtgcacttatgagcagggatttaggaaagttgatccagataggtgggagtttgcaaacgaaggttttcttagaggacaaaagcatctactgaagaccatcaacagaaggaaaccaactcatggaaacaaccaagttcagcagcctcagttgccagctgctcctgtacctgcttgcgtagaagtggggaagtttgggatggaagaagagattgagatgctcaaaagggataaaaatgttttaatgcaggaacttgtcaggctgagacaacaacagcagacaacagatcatcagctgcagactttgggcaagcgtcttcaaggaatggagcaacggcaacaacaaatgatgtctttcctggctaaggcaatgcatagtcctggcttcctagcacaatttgtacagcaaaacgaaaacagcagaagaagaatagttgctagtaacaaaaagaggaggctaccaaagcaggatggttcgttggactctgaaagtgcttcattggatggacaaatagtaaaatatcaacctatgatcaatgaagcagccaaagcgatgctaaggaagatcctaaagctagattcttcacatagatttgaatccatgggcaattcagataatttccttcttgagaattatatgccaaatggtcaaggtcttgacagctcttcatcaactcggaattctggtgttacccttgcagaggtcccagctaactcaggtttgccatatgtagctacaagctctggactttcagctatttgttcaacttcgactcctcagattcagtgcccagttgttttggacaacggcatacccaaagaagttccaaacatgagtgcggtgccttctgttccgaaggctgtggctccaggcccaactgatatcaatattctggaattcccagatttgcaagatatagtagctgaagaaaatgttgatattcctggagggggctttgaaatgcctggtcctgagggtgtattctctttgcctgaagaaggtgatgatagtgttcccattgagactgatgagattttgtacaacgatgacacccagaaacttcctgctatcattgattctttctgggaacagttcctggtggctagccctctatctgttgataatgatgaagtcgattcaggtgtactagaccaaaaggaaacacaacaggggaatggatggaccaaagctgaaaacatggctaaccttacagaacagatgggcctcctgtcatcacaccatacaggatgatgaggtacaataggacatacttagccaccatttgtcaaggtaccctgggatctcggtaataaactcccacatcatcacctacccttatgtctatgttatgttctatcattttgctgaaacaatactgaaacgtcaccctatatgtgggaggatactaatcttccacctatgaaacacggtttacccgaggggtttacctgcttgtatctaggtttggcaggcgtaagaattgatcaatggtaacttgtcaaatctgtatgatagctactttgtgttgtagctactgatagctttttttttttgttcttgcctgctctatctgattgcaactaacttctggtagtactggcagtctgccacactgtattgattccaaaattaagtaactttgactgtttcagattc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0854500, RefSeq:Os03g0854500