Difference between revisions of "Os01g0121700"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
The name of the gene is half-size adenosine triphosphate-binding cassette transporter subgroup G,OsABCG1or OsWBC1,is a Putative ATP-binding-cassette protein,belongs to the ABC transporter superfamily.
 
===Function===
 
===Function===
Please input function information here.
+
ATP-binding cassette transporters (ABC transporters) are transmembrane proteins that utilize the energy of adenosine triphosphate (ATP) binding and hydrolysis to carry out certain biological processes including translocation of various substrates across membranes and non-transport-related processes such as translation of RNA and DNA repair. They transport a wide variety of substrates across extra- and intracellular membranes, including metabolic products, lipids and sterols, and drugs. Proteins are classified as ABC transporters based on the sequence and organization of their ATP-binding cassette (ABC) domain(s).
The name of the gene is half-size adenosine triphosphate-binding cassette transporter subgroup G,OsABCG1or OsWBC1,
+
 
 +
ABC proteins are characterized by a highly conserved amino acid region, the ATP binding cassette, also known as the nucleotide binding domain (NBD). This domain contains conserved motifs known as Walker A and Walker B sequences, an ABC signature motif, an H loop, and a Q loop . Half-size ABC proteins consist of only one core unit, while full-size ABC proteins have two or more core units. Full-size ABC proteins can function alone, whereas half-size ABC proteins must form homo- or heterodimers to function as transporters.
 +
===Mechanism of function===
 +
The general mechanism for the transport cycle of ABC transporters has not been fully elucidated but substantial structural and biochemical data has accumulated to support a model in which ATP binding and hydrolysis is coupled to conformational changes in the transporter. The resting state of all ABC transporters has the NBDs in an open dimer configuration, with low affinity for ATP. This open conformation possesses a chamber accessible to the interior of the transporter. The transport cycle is initiated by binding of substrate to the high-affinity site on the TMDs, which induces conformational changes in the NBDs and enhances the binding of ATP. Two molecules of ATP bind, cooperatively, to form the closed dimer configuration. The closed NBD dimer induces a conformational change in the TMDs such that the TMD opens, forming a chamber with an opening opposite to that of the initial state. The affinity of the substrate to the TMD is reduced, thereby releasing the substrate. Hydrolysis of ATP follows and then sequential release of Pi and then ADP restores the transporter to its basal configuration. Although a common mechanism has been suggested, the order of substrate binding, nucleotide binding and hydrolysis, and conformational changes, as well as interactions between the domains is still debated.
 
===Expression===
 
===Expression===
Please input expression information here.
+
ATP-binding cassette transporters (ABC transporters) are members of a protein superfamily that is one of the largest and oldest families with representatives in all extant phyla from prokaryotes to humans.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
Adenosine triphosphate (ATP)-binding cassette (ABC) proteins exist in a wide range of organisms from prokaryotes to eukaryotes.Genome wide analysis of model plants such as Arabidopsis and rice (Oryza sativa L.) has revealed that plants have more than 120 ABC proteins, much more than animals or insects.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 12:39, 9 June 2014

Please input one-sentence summary here.

Annotated Information

The name of the gene is half-size adenosine triphosphate-binding cassette transporter subgroup G,OsABCG1or OsWBC1,is a Putative ATP-binding-cassette protein,belongs to the ABC transporter superfamily.

Function

ATP-binding cassette transporters (ABC transporters) are transmembrane proteins that utilize the energy of adenosine triphosphate (ATP) binding and hydrolysis to carry out certain biological processes including translocation of various substrates across membranes and non-transport-related processes such as translation of RNA and DNA repair. They transport a wide variety of substrates across extra- and intracellular membranes, including metabolic products, lipids and sterols, and drugs. Proteins are classified as ABC transporters based on the sequence and organization of their ATP-binding cassette (ABC) domain(s).

ABC proteins are characterized by a highly conserved amino acid region, the ATP binding cassette, also known as the nucleotide binding domain (NBD). This domain contains conserved motifs known as Walker A and Walker B sequences, an ABC signature motif, an H loop, and a Q loop . Half-size ABC proteins consist of only one core unit, while full-size ABC proteins have two or more core units. Full-size ABC proteins can function alone, whereas half-size ABC proteins must form homo- or heterodimers to function as transporters.

Mechanism of function

The general mechanism for the transport cycle of ABC transporters has not been fully elucidated but substantial structural and biochemical data has accumulated to support a model in which ATP binding and hydrolysis is coupled to conformational changes in the transporter. The resting state of all ABC transporters has the NBDs in an open dimer configuration, with low affinity for ATP. This open conformation possesses a chamber accessible to the interior of the transporter. The transport cycle is initiated by binding of substrate to the high-affinity site on the TMDs, which induces conformational changes in the NBDs and enhances the binding of ATP. Two molecules of ATP bind, cooperatively, to form the closed dimer configuration. The closed NBD dimer induces a conformational change in the TMDs such that the TMD opens, forming a chamber with an opening opposite to that of the initial state. The affinity of the substrate to the TMD is reduced, thereby releasing the substrate. Hydrolysis of ATP follows and then sequential release of Pi and then ADP restores the transporter to its basal configuration. Although a common mechanism has been suggested, the order of substrate binding, nucleotide binding and hydrolysis, and conformational changes, as well as interactions between the domains is still debated.

Expression

ATP-binding cassette transporters (ABC transporters) are members of a protein superfamily that is one of the largest and oldest families with representatives in all extant phyla from prokaryotes to humans.

Evolution

Adenosine triphosphate (ATP)-binding cassette (ABC) proteins exist in a wide range of organisms from prokaryotes to eukaryotes.Genome wide analysis of model plants such as Arabidopsis and rice (Oryza sativa L.) has revealed that plants have more than 120 ABC proteins, much more than animals or insects.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0121700

Description

ABC transporter related domain containing protein

Version

NM_001048413.1 GI:115434239 GeneID:4326045

Length

6489 bp

Definition

Oryza sativa Japonica Group Os01g0121700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:1223012..1229500

Sequence Coding Region

1224084..1224269,1224578..1224662,1224763..1224975,1225114..1225334,1225511..1225642
,1226218..1226494,1226887..1227088,1227779..1227911,1228241..1228391
,1228484..1228674,1229167..1229382

Expression

GEO Profiles:Os01g0121700

Genome Context

<gbrowseImage1> name=NC_008394:1223012..1229500 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:1223012..1229500 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggtcaggggtctgggccagctcctggccgcgctcgccgcggcgctgttcgtccgcgccgtcgccggcccgggcccggcgctcctccctccggccgacgacgaggactccgacgccgacccggaggccggcggggaaggaggcggcgtgcctccggtgacgataaggtgggcccgcatcacctgcgccctcaagaacaagcgcggcgacgtggcgaggtttttgctgtcaaatgcgtctggggaggcgaaatcggggaggctgcttgcgctcatggggccatcagggtccggtaaaacgactctgctcaatgtgcttgctggtcagctcacagcatcaccttctttgcacctttctgggtttctgtacatcaatggccgacctatctcagaaggtggctataagattgcttacgtgaggcaagaggaccttttcttctcacagcttactgttcgtgaaacgctctcgcttgctgctgaacttcagcttcgccgcacgttgactcctgagaggaaggaaagctatgttaatgaccttttgtttcgtcttgggctggttaactgtgctgactcaattgtgggtgatgcaaaagtacgtggaataagtgggggtgaaaagaagcgtctctcccttgcgtgtgaactgattgctagcccttctatcatctttgcagacgaaccaactactggtcttgatgcgttccaggcagagaaggtcatggaaactcttagacagcttgcagaagatggacacacggtgatatgttctatacatcagccaagaggttcagtttatggcaaatttgatgatattgtactactgtcagagggagaagttatatacatggggccagcaaaagaggaaccgttattgtactttgcatcattggggtatcattgtccagatcatgtgaaccctgctgagttcttggctgatctcatttctgttgattatagttctgctgaaagtgtgcagtcatcacggaaaaggattgaaaacctcattgaagaattttctaataaagttgcaattactgaaagcaacagttcgctgacaaatccagaaggctctgaattttctcccaaacttattcagaagtccaccaccaagcatagacgtgggtggtggagacaattccgtttgctgtttaagagagcatggatgcaggctttccgtgatggaccaacaaacaaagtgagagcaagaatgtccgttgcttcagcaatcatatttggatctgtgttctggcgaatggggaaaactcagacttccatacaagacaggatgggacttcttcaggtaactgctataaacacagcaatggctgcactgacaaagacagtaggagttttcccgaaagagcgggctatagttgacagagaacgggccaaaggttcctatgcactaggaccatacctttcttctaagttgttggctgaaattcctattggggctgcattcccattgatatttggatccattctttatccaatgtctaaacttcatcctacattttctagatttgccaagttctgtggcatcgtgactgttgaatcatttgctgcatcagccatgggccttactgttggagctatggctcctacaacagaagccgccatggcccttggaccatcccttatgacagttttcattgtatttggaggatactatgttaaccctgataatacccccgtcatttttcgctggatcccaaaagtatccctaattagatgggccttccaagggctttgcattaatgagttcaaaggtttgcaatttgagcaacagcattcctatgacattcaaactggtgaacaggccctggagaggttttcattaggaggaatccgcattgcagacacgcttgtggcacagggtagaattctgatgttctggtactggttaacctaccttcttctgaagaaaaacaggccaaagtatcagcagcttctaccaccatctgaggaagatcaaaataagcagcaagttaaggaagtgaaatga</cdnaseq>

Protein Sequence

<aaseq>MEVRGLGQLLAALAAALFVRAVAGPGPALLPPADDEDSDADPEA GGEGGGVPPVTIRWARITCALKNKRGDVARFLLSNASGEAKSGRLLALMGPSGSGKTT LLNVLAGQLTASPSLHLSGFLYINGRPISEGGYKIAYVRQEDLFFSQLTVRETLSLAA ELQLRRTLTPERKESYVNDLLFRLGLVNCADSIVGDAKVRGISGGEKKRLSLACELIA SPSIIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYGKFDDIVLLS EGEVIYMGPAKEEPLLYFASLGYHCPDHVNPAEFLADLISVDYSSAESVQSSRKRIEN LIEEFSNKVAITESNSSLTNPEGSEFSPKLIQKSTTKHRRGWWRQFRLLFKRAWMQAF RDGPTNKVRARMSVASAIIFGSVFWRMGKTQTSIQDRMGLLQVTAINTAMAALTKTVG VFPKERAIVDRERAKGSYALGPYLSSKLLAEIPIGAAFPLIFGSILYPMSKLHPTFSR FAKFCGIVTVESFAASAMGLTVGAMAPTTEAAMALGPSLMTVFIVFGGYYVNPDNTPV IFRWIPKVSLIRWAFQGLCINEFKGLQFEQQHSYDIQTGEQALERFSLGGIRIADTLV AQGRILMFWYWLTYLLLKKNRPKYQQLLPPSEEDQNKQQVKEVK</aaseq>

Gene Sequence

<dnaseqindica>5232..5417#4839..4923#4526..4738#4167..4387#3859..3990#3007..3283#2413..2614#1590..1722#1110..1260#827..1017#119..334#ccccccccccccctcgtcttcctcctcttcactcctcgtcgcacgcgacgtgaaccttccagaagcttctagaacagtcgtcaggcctctctccgctcgtcccccgcgcgcgcgcgagatggaggtcaggggtctgggccagctcctggccgcgctcgccgcggcgctgttcgtccgcgccgtcgccggcccgggcccggcgctcctccctccggccgacgacgaggactccgacgccgacccggaggccggcggggaaggaggcggcgtgcctccggtgacgataaggtgggcccgcatcacctgcgccctcaagaacaagcgcggcgacgtggtgagtcgctctgcctcgaatcatccattccgttccctctcgccggaggagtcgcattggtcggcggcgctgcgcgcacggaaagaaaaaaaaaatcatctgcttaggattagccaggagagccgcgtgctgtctgagagactgacactgggccctacctgtcgatgtggcactgactcatcacattttagatgaacaggttgctgaaatttgtttcgcacttccgctgttggctaacgggctaagtaattgcgtggcattctgcagtctgtatgtagaattgtatattaatttgcgtcgaacaagtaatttgcgaaatttgtttcacactttcaccgtctgcactctgcagcttcaatcagtagatgaacacaccgaagctgtgtattctgtatgtagaattgtacattgagtgccatcaataatcggaatttcttgcttctgcgcgtctctgggtgattgttgtaatggttataacgtgctgcatgccaggcgaggtttttgctgtcaaatgcgtctggggaggcgaaatcggggaggctgcttgcgctcatggggccatcagggtccggtaaaacgactctgctcaatgtgcttgctggtcagctcacagcatcaccttctttgcacctttctgggtttctgtacatcaatggccgacctatctcagaaggtggctataagtaagcttaagctatgcttcttcagttggctttcacaattttttagtcaggtttacagagaagagctatactcattgcttttccttgtgtaggattgcttacgtgaggcaagaggaccttttcttctcacagcttactgttcgtgaaacgctctcgcttgctgctgaacttcagcttcgccgcacgttgactcctgagaggaaggaaagctatgttaatgaccttttgtttcgtcttgggctggtaagttatccatgatggtatatggtctgctttctaaagaaaaagttatccatgatggttaaaatgttcgaagaaattgaaccaattggttttagtgcactacatcaaatgttggatacgaacttgtagtttctagcactggtggagaaaatctgtcaaattacacatgaaaagcattgttattttggtgctcagatagatgacaagtatgctaagtttttcaattgatgggcagaacctacataatatctatcgctgtctgttcaagtatttccctttttattttgtatcaccaggtatttatttctttttattataactggttgtaggttaactgtgctgactcaattgtgggtgatgcaaaagtacgtggaataagtgggggtgaaaagaagcgtctctcccttgcgtgtgaactgattgctagcccttctatcatctttgcagacgaaccaactactggtacttttacctgactgtagtgtttatttaacccttccttggttgaataagcattctcatctcctcttaatgttttcgttaggaaatacatgactagttgcaagcaaatgttctgatcacttcttcaaatctactgtttctttgtaaatttgtgccatgcttcttttttttattggaaccagcacgagaatgtgctttttcattaaatatagcaggagaaaaatacagcccctaagggcaaagaaaaagaaaatttgtagccatgccggattcaagtgaaaatagattgccaatactgcgatagttgcattaaaatggcttcaatagatacaccacatttttctcatgccacaagaattgctttaagatgatgcatgtttcttgtactaagactgctactctaatggttaacacatgacatatcataatcttggtggcatctttaatcaagcaccatggtattgggacttgccttattagatttgtcattgaatgctgcaaacaaaatatattcttgatatgatatacaagctacatcccttctggacaaagtgttgcacatttactttatctgaagtgttgagcttccatgattagagatagcgcattcattggtcctttgatgtgacaaaagtgcaaaacataagtgagattgcataaactttgttcacatatgtgccatccttttaggtcttgatgcgttccaggcagagaaggtcatggaaactcttagacagcttgcagaagatggacacacggtgatatgttctatacatcagccaagaggttcagtttatggcaaatttgatgatattgtactactgtcagagggagaagttatatacatggggccagcaaaagaggaaccgttattgtactttgcatcattggggttggtattcgctcaccttttcctttacttggcatttcctgttgttttcgatgtgtgcattgtactgattttatttagactgtaatactctactaccttggtgcataacatgatagtggtcatatttgtccttgttagtggcactatccaaaattccagtgtacggtatgctagaattttactcagaattttaattaggcatgcagattctggcttgtgtacttgttcacaccataatggagattatcttgcttttataagttcttttatctattatcagatgtgttggtttctatattctatgtatactgtcaatatgctatgctgcttgtttttctgcctgctattattgcttatcaataacttgagtttgattacttcatatttttcaggtatcattgtccagatcatgtgaaccctgctgagttcttggctgatctcatttctgttgattatagttctgctgaaagtgtgcagtcatcacggaaaaggattgaaaacctcattgaagaattttctaataaagttgcaattactgaaagcaacagttcgctgacaaatccagaaggctctgaattttctcccaaacttattcagaagtccaccaccaagcatagacgtgggtggtggagacaattccgtttgctgtttaagagagcatggatgcaggttttattaaaattcatttaattctcagttgcagcttcctcttttaatctgcttcccgctgcttctttaaatcaagttgatatgtttatttattatttgctgtggaagttatcagatactcgtgaggcttcctttcaaaaaaatcgtttttcttacatattcttttagcctgagtaaactatatacataatgtaatgaatttaggaggtttagatcgaacatgttactatatttgagtttggatccatgatttagtttttgccaaatctgtgcctcaaaaaggtgtaatacgcaactgcccatgaaacatacttgtaaacaaaaaagaaacactttgctaatggaactatgaggatttggattgtggttgattgtaaacaaaaaggaaacactttgctaatggaactataaggatttggattgtggttgaggttatctgactaatgttcaagccttttatagtttgcctgggtacccattaataatctgagcgcagttgcttagatggggtttagctaaagatttactgccacgctgttgtgtctgatattggaataggaccttctgtgttttaggctttccgtgatggaccaacaaacaaagtgagagcaagaatgtccgttgcttcagcaatcatatttggatctgtgttctggcgaatggggaaaactcagacttccatacaagacaggatgggacttcttcaggtagaatatgttggattttttatgactcgttgagttgaatttgctaggttgcacatgcttcagattttggacttacattcattctcttcctaatattgactttggtacaagctttttcattgtgtctgagcatttttctgattttgatctgtccctttttcaatttatgagttaaggtaactgctataaacacagcaatggctgcactgacaaagacagtaggagttttcccgaaagagcgggctatagttgacagagaacgggccaaaggttcctatgcactaggaccatacctttcttctaagttgttggctgaaattcctattggggctgcattcccattgatatttggatccattctttatccaatgtctaaacttcatcctacattttctaggtaagtattatcctccctctaatttagaaatgaatctgaggcactttattacatgccacgcagaaatagtagaatatcgatagttcgatactattttgtttatgctccatcaaacaacattccatgctacactttcagatttgccaagttctgtggcatcgtgactgttgaatcatttgctgcatcagccatgggccttactgttggagctatggctcctacaacagaagccgccatggcccttggaccatcccttatgacagttttcattgtatttggaggatactatgttaaccctgataatacccccgtcatttttcgctggatcccaaaagtatccctaattagatggtaaccctcttccttatatcatattttggctcctaagctaggtgggaccgtgggatagttaatgaccctatatttcaactttgtttgccattgatttcagggccttccaagggctttgcattaatgagttcaaaggtttgcaatttgagcaacagcattcctatgacattcaaactggtgaacaggtacggttgttcatgtggacctgcaaaaggcagttttacatttttactgttacaaaaatgcagacacacacttggttaagtgccagtgagatattgctcgacctaagttaatgtttgaatgataatgcactcaaacagaaaattggcccagacactattcatgtgttatcatcacattcaattaaaaatctgaattgaaaattttccttgaattgtaactggggcctgggtaaaaaggtgaacctttggcatatctttcttctatggaggggaagtgatctgcttttgacacattacttctatggcaggccctggagaggttttcattaggaggaatccgcattgcagacacgcttgtggcacagggtagaattctgatgttctggtactggttaacctaccttcttctgaagaaaaacaggccaaagtatcagcagcttctaccaccatctgaggaagatcaaaataagcagcaagttaaggaagtgaaatgaagtgctgccagcaacattttgccagcaaaggtaaaagagacattagcattaaccacgtttcacacaatggtcctaatctcctgaaatattttttgtcaggatgtactgcaattagaaaacgtaactgttgtatcatattgagcattagttgtatggccctttttgtagttaatattctttttgtagcatctgaatgggaaattatggcctaaataattttgggggtagcaagcattccttcattctatagtcttgcatctatagaagacttatccccattcccagaatgactgtcttgttatcaagcacatcgtttttagttgcccagaaatgcattgtcatcaagttgttgtacccacttagattaacattgctagaagccgagaactctgaagcctttataagatctaattgctacagatatggtgtttgggaagtagtttagttgacagtagcataaatcaggaatcatgacccatgttgtaaacttcaagatccatgcatcttgtgtttcttgtgacctctaggcactcaattctgcaattgcttcaagtcttgaacccttgagcccatttgagtagctttgctgatgatgccatatactaatatctccttgaccatgtgccaactgatggcagctagggatctgcactagcattcaggctatgtgataaacaacttagccaatagtatgatagtactataatttctcctctttgccaattgctaactgttttctttttttttttcttatcagagagaagctgcaccttcttcacagcatctcggcatgagaatgagaggatcactaaatcatgcggcaataaaacaattagccgcccaagcccatcactttgaagcagtacatcaactcaactgaatgattaatttcctcttttcttttttgtcaagcaagtactcgtagtaatagtattcaactcaataatgggagatggccggtgttggttggaagcgacgagtcgctgcattcgatgtgattacttctaaactatttattgttccatgattccttccctgaataaatcaccggccaaaatgtgccatgtggact</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0121700, RefSeq:Os01g0121700