Difference between revisions of "Os07g0558500"

From RiceWiki
Jump to: navigation, search
(Mutation)
Line 9: Line 9:
 
*The nyc4-1 mutation was induced by a translocation-related chromosomal rearrangement
 
*The nyc4-1 mutation was induced by a translocation-related chromosomal rearrangement
 
*The nyc4-1 was obtained from a rice (Oryza sativa L. cv. Nipponbare) M2 population derived from seeds irradiated with carbon ion beams (200 MeV). For dark-induced senescence, detached leaves were incubated in water at 28ºC.
 
*The nyc4-1 was obtained from a rice (Oryza sativa L. cv. Nipponbare) M2 population derived from seeds irradiated with carbon ion beams (200 MeV). For dark-induced senescence, detached leaves were incubated in water at 28ºC.
[[File:111111111.jpg]]
+
[[File:111111111.jpg]]Figure 1  A comparison between Nipponbare and nyc4-1 mRNAs in pre-senescent (0 DAD) and senescent (3, 5 and 8 DAD) leaves revealed that expression of Os07g0558500, which is located within the mapped region of chromosome 7, was drastically reduced in nyc4-1.
  
 
===Expression===
 
===Expression===

Revision as of 13:14, 9 June 2014

The rice Os03g0149100 was reported as the stay-green mutant non-yellow coloring 4 (nyc4) by researchers from Japan.

Annotated Information

Function

  • NYC4 encodes the ortholog of Arabidopsis THF1. nyc4 retained chlorophyll during senescence, although changes in other senescence parameters indicated that senescence proceeded, suggesting that nyc4 is a non-functional stay-green mutant.
  • In nyc4, the Fv/Fm value, which reflects PSII activity, remains at a high level during senescence. This is a very different characteristic from those observed in the non-functional stay-green mutants sgr and nyc3

Mutation

  • The nyc4-1 mutation was induced by a translocation-related chromosomal rearrangement
  • The nyc4-1 was obtained from a rice (Oryza sativa L. cv. Nipponbare) M2 population derived from seeds irradiated with carbon ion beams (200 MeV). For dark-induced senescence, detached leaves were incubated in water at 28ºC.

111111111.jpgFigure 1 A comparison between Nipponbare and nyc4-1 mRNAs in pre-senescent (0 DAD) and senescent (3, 5 and 8 DAD) leaves revealed that expression of Os07g0558500, which is located within the mapped region of chromosome 7, was drastically reduced in nyc4-1.

Expression

NYC4 is expressed in various tissues, but is expressed more strongly in green tissues such as the leaf, stem, lemma and palea . Expression of NYC4 was down-regulated within 24 h of dark incubation, and then gradually increased during the extended dark incubation, and finally reached the level similar to that observed before dark incubation. This expression pattern is consistent with the function of NYC4: acclimation to high light and promotion of chlorophyll degradation in senescence.

Knowledge Extension

  • Ionizing radiation often induces chromosomal rearrangements such as inversions and translocations, which cause gene disruptions or, in some cases, gene fusions. In most cases, these mutations are loss-of-function and recessive; however, both loss-of-function and gain-of-function mutations are possible for gene fusions. Theoretically, these mutations may involve two gene mutations associated with two chromosomal breakpoints.
  • NYC4 encodes an ortholog of THYLAKOID FORMATION1 (THF1) in Arabidopsis thaliana. THF1 is a multi-function protein that is involved in acclimation to high light, sugar sensing and disease resistance.

Labs working on this gene

  • Graduate School of Science, Hiroshima University, Higashi-Hiroshima 739–8526, Japan
  • Genome Resource Unit, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
  • Institute of Plant Science and Resources, Okayama University, Kurashiki 710-0046, Japan
  • Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachi-Ohmiya 219-2293, Japan
  • Faculty of Life and Environmental Sciences, Prefectural University of Hiroshima, Shobara 727-0023, Japan
  • Institute of Low Temperature Science, Hokkaido University, Sapporo 060-0819, Japan

References

1 Yamatani, H. et al. NYC4, the rice ortholog of Arabidopsis THF1, is involved in the degradation of chlorophyll - protein complexes during leaf senescence. The Plant journal : for cell and molecular biology 74, 652-662, doi:10.1111/tpj.12154 (2013). 

Structured Information

Gene Name

Os07g0558500

Description

Inositol phosphatase-like protein

Version

NM_001066511.1 GI:115472754 GeneID:4343584

Length

3989 bp

Definition

Oryza sativa Japonica Group Os07g0558500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:22979321..22983309

Sequence Coding Region

22979511..22979604,22979898..22980013,22981139..22981355,22981799..22982069,22983047..22983212

Expression

GEO Profiles:Os07g0558500

Genome Context

<gbrowseImage1> name=NC_008400:22979321..22983309 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:22979321..22983309 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggccatatcttcgcttcccttcgcggcactgcgccgggccgccgactgcaggccgtcgacggcggcggcggcggcgggggcgggggcgggggccgtcgtgctcagcgtgaggccccggcgggggtcgcgctcggtggtgcgctgcgtcgccacggcgggcgatgttccacccactgtcgcagaaacaaagatgaattttctcaagtcatacaagcgtcctatcctaagcatttacagtacagttctacaagaacttttggtacagcaacatctgatgagatacaaaacaacatatcaatatgatgcggtgtttgctcttggttttgtgaccgtctatgaccaactcatggaagggtaccctagcaatgaggatagggatgcaatcttcaaagcatatataacagcgttaaacgaagaccctgagcaatacagagctgacgcacaaaagatggaagagtgggctcgttcccagaatggtaattctttagttgagttttcatccaaagatggagaaatagaggccattctgaaagatatttcagaaagggcccagggtaagggaagcttcagctacagccggttctttgcagttggcttgttccgtttgcttgagcttgcaaatgcaacagagccaaccatactagacaagctttgcgctgctctaaacatcaacaaaagaagtgtcgacagggatctcgatgtttaccggaacatactctccaaattggtccaggctaaggaacttctcaaggaatacgtggaaagggaaaagaagaagagagaggaaagatcagagaccccaaaatcgaatgaagctgttacgaaatttgacgggagtctcaattccatgaggcattaa</cdnaseq>

Protein Sequence

<aaseq>MAAISSLPFAALRRAADCRPSTAAAAAGAGAGAVVLSVRPRRGS RSVVRCVATAGDVPPTVAETKMNFLKSYKRPILSIYSTVLQELLVQQHLMRYKTTYQY DAVFALGFVTVYDQLMEGYPSNEDRDAIFKAYITALNEDPEQYRADAQKMEEWARSQN GNSLVEFSSKDGEIEAILKDISERAQGKGSFSYSRFFAVGLFRLLELANATEPTILDK LCAALNINKRSVDRDLDVYRNILSKLVQAKELLKEYVEREKKKREERSETPKSNEAVT KFDGSLNSMRH</aaseq>

Gene Sequence

<dnaseqindica>3706..3799#3297..3412#1955..2171#1241..1511#98..263#acgcgcctttttgcgcctaatttaccgttttacccctcgccggcggccgccgcactccggcgagagaatcggcagcaggtgggcgggggactccacgatggcggccatatcttcgcttcccttcgcggcactgcgccgggccgccgactgcaggccgtcgacggcggcggcggcggcgggggcgggggcgggggccgtcgtgctcagcgtgaggccccggcgggggtcgcgctcggtggtgcgctgcgtcgccacggcgggcggtgagcttgctcgctcgcgctctctctgttttttttctctcactcactggtgcttctggcgtcggtgatgaacacgtagtggtagtgcgttcgattgcgacagaagagcttctctttttgcgtgggggtttcactagcaaaatctggatcctggttcttcttggggatgctgcaagattgtttgtggcggggactacaagccaatctagcgtcctatgtttggaggaagaactggcaactgtgatttttgggtgaacaattagcatttgtagttgtgtatccatgcggttttgatgcttggttattctttctagcagggaattcatgtctgttttagatgcgagcttgggaatttttttagaatttcgtatcactagtttagccatatgtgattttcaacaatctagctgattttgatccacaaatagcgaagggtaggactattcagttgtgtatttgttttttgccgggtcggcgaaggagccgaccaaatttcattaagaatgaaaggagagtttacaagtttacacgacattaaactgtcgagccggggagaccccggagcagagaaacaggatcagttgtgtatttgcgccaatcatcttatgttagccaaacctcacaagccctggttagctgttcaggcctatgattcctgcttttctgttgaattgtggcagtaaactgccaaatgcttccttgtagaacgatttgatgcgtttacatatttccgctcatttcgttccacagtttcttcatggtgttctgttgcttctgccccctttcctgtcaactttcttcaattcatcgagcaagtgccgattacttgtcaagtatttgatactggatcattgtatgtccaaatgttttcagttattatgatcacaaaggcagcaactaacttataacatattgtacacagcatgatgaacaagttatcgccacagcgtttttcacttgttctgaatattgtgcagatgttccacccactgtcgcagaaacaaagatgaattttctcaagtcatacaagcgtcctatcctaagcatttacagtacagttctacaagaacttttggtacagcaacatctgatgagatacaaaacaacatatcaatatgatgcggtgtttgctcttggttttgtgaccgtctatgaccaactcatggaagggtaccctagcaatgaggatagggatgcaatcttcaaagcatatataacagcgttaaacgaagaccctgagcaatacaggtgcctactgtaacttacaactgttttttattcacagtgatgttagcatcttcttgttttatattcaattagatttctcataaccaaattgaaccttcaaacaatatcctacacttaattgatccaagtaatttttttatagatttatataattcacagccatgaattttcagcataaatattacccccaattcgttgaattcatatgtcaaccatagccttttcctatagagatagtagcaattatctatcttgccgctgtaaaaaatgtcacattttgcactatctatttgttgcatgctttgcttatttgtggatcaccaattatctgctttatttgcgtcaatgaaagctaatgtattattgggttactagtttgttttggcatcaacagaggtgtctttccaagcaatcatagtaagtgttttctgttctttcttcagagctgacgcacaaaagatggaagagtgggctcgttcccagaatggtaattctttagttgagttttcatccaaagatggagaaatagaggccattctgaaagatatttcagaaagggcccagggtaagggaagcttcagctacagccggttctttgcagttggcttgttccgtttgcttgagcttgcaaatgcaacagagccaaccatactagacaaggttgttattgccattaataattttgtttctgactatcatacttatttttgcttcacttccaaattatatcttctaataacgcttatgtgtgtttctcaagttatattttagagagcatgtttccaatacattttagttttcgcagaaagaaaggatttatctcaaatcaattaaggggttggcttgtgtctgctgtctaatatcttgcaaccacagctggttaagtgtctatgcggtgttctttttaacctactacttcgctgatatgctagattactagtaaaggactaagtctgactctattccatcctacagcgtacgggcctgtttggcacagttctaactccagttccgcctctcctggagttggagcccagccaaatagttcaactccacctaaaatgggagtggagctgggtggagcgctctcacaaaatgaactagagaggtggagcttgggtttaggcagctccacaactccactccgaacccaactcctagagttaaattttaggagttggagctctaccaaacatgccctccatacctattgactaagcctctgactcgactccatcatactttcctattgactaagcctcttactcgactccatcattcattcctatcacttcagaaccacagctcccacctctaaaatctaactaccctagctgagtgcgcacgaactgctttcctaaatatttctcctcaaacgttgaggttagcaaatgttctaatcgttatggcatgtgatcaactgacaattcaagtttgtgatggtttctattatttatgatgtttcttaagccagaataggaaatagcactaaggaggttcgagttcagttttggcttctaacttagtaccaatgttgggggcatatctggacttttctgtgggaggactcattggagatagggagattccatacaggataaaactccaaaagcattcttgaggcattctagtatagtacaagtcaagtaattttttcagtgtccaatgataatttcaggaaacatttaagccagttatgtttgtcatttggtgaactcaaaatgtaatgtgcactttgatgttacctacttacctcactaatattttcaatggcttccttgacagctttgcgctgctctaaacatcaacaaaagaagtgtcgacagggatctcgatgtttaccggaacatactctccaaattggtccaggctaaggaacttctcaaggaatacgtggaaaggtaaccaacttatccgctgatttcccacttctcttactgcccaaaccctgatttgttcaatcactgatattactaacgcacgagggatgttcctaattttattttgcaacaattgtgtgatattaatagctttatacttgaagtttactgtttagcacataaatctctcctctttcaatgagcccaggcaaatggattagtttatattgccttctctttacattttgtatcctccccagtttttctgtgttaaactgatcatctcaacgagttgaactcaactttgttggcagggaaaagaagaagagagaggaaagatcagagaccccaaaatcgaatgaagctgttacgaaatttgacgggagtctcaattccatgaggcattaactcaagccttcataaggggagtgagtgctaccgtggataacagattttaacagagttctggatcacgttgagaaactatcaaggtcacctttcactgcacggacactttggctgctctcgtgtggttttgtattctgccgtataaaaggatccagattgttcttactactgagcattatattttttttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0558500, RefSeq:Os07g0558500