Difference between revisions of "Os05g0530400"

From RiceWiki
Jump to: navigation, search
(Function: encode heat stress transcription factor/make plants tolerant to cell death/)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
A plant is subject to various kinds of environmental stresses, including water, temperature, light, and soil. These stresses can cause various types of
 +
physiological damage in plants. Because they cannot move, plants can defend themselves against such stresses only by making metabolic and structural adjustments. To achieve this defense, genes need to be expressed in response to a stress stimulus to induce or suppress the production of specific proteins, such as heat shock proteins (HSPs). Thus, plants develop stress tolerance at the cellular level.
 +
Firstly, Spl7 encodes a heat stress transcription factor (HSF) protein. We also discuss the role of Spl7 in making plants tolerant to cell death caused by environmental stresses, such as high temperature.
 +
Moreover, an Spl7 mutant plant was susceptible to several pathogens and showed very low expression of the five genes strongly correlated with the onset of defense response. Spl7 lesions could not be readily triggered by mechanical wounding. Thus, the lesion formation of spl7 might not be directly associated with hypersensitive-response cell death. Rather, it seems to be necrosis caused by environmental stresses.
  
 
===Expression===
 
===Expression===

Revision as of 14:54, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. A plant is subject to various kinds of environmental stresses, including water, temperature, light, and soil. These stresses can cause various types of physiological damage in plants. Because they cannot move, plants can defend themselves against such stresses only by making metabolic and structural adjustments. To achieve this defense, genes need to be expressed in response to a stress stimulus to induce or suppress the production of specific proteins, such as heat shock proteins (HSPs). Thus, plants develop stress tolerance at the cellular level. Firstly, Spl7 encodes a heat stress transcription factor (HSF) protein. We also discuss the role of Spl7 in making plants tolerant to cell death caused by environmental stresses, such as high temperature. Moreover, an Spl7 mutant plant was susceptible to several pathogens and showed very low expression of the five genes strongly correlated with the onset of defense response. Spl7 lesions could not be readily triggered by mechanical wounding. Thus, the lesion formation of spl7 might not be directly associated with hypersensitive-response cell death. Rather, it seems to be necrosis caused by environmental stresses.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0530400

Description

Heat stress transcription factor Spl7 (Heat shock transcription factor) (Heat shock factor RHSF10)

Version

NM_001062662.1 GI:115465054 GeneID:4339409

Length

2463 bp

Definition

Oryza sativa Japonica Group Os05g0530400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:26405672..26408134

Sequence Coding Region

26406272..26406508,26406746..26407888

Expression

GEO Profiles:Os05g0530400

Genome Context

<gbrowseImage1> name=NC_008398:26405672..26408134 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:26405672..26408134 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagagttccaacctgggcggcggcggcggcggaggcggcggcggtgggccgccgccgttcttgatcaagacgtacgagatggtggaggacgcggcgaccaaccacgtcgtgtcgtggggccccggcggcgccagcttcgtcgtgtggaacccgctcgacttctcccgtgacctgttgcccaagtacttcaagcacaacaacttctccagcttcatcaggcagctcaacacctacggtttccgaaaaatcgatcctgagagatgggagttcgcaaacgaggatttcataagagggcacacgcaccttctgaagaacatccatcgacgcaagcccgtgcacagccactccctccagaaccagataaacggaccactcgccgaatcggagaggcgcgagctcgaagaagagatcaaccggctcaagtacgagaagagcatcctcgtcgcggacctccagaggcagaaccagcagcagtacgtgatcaactggcagatgcaggcgatggaaggcaggctagtggcgatggagcaacggcagaagaacatcgtggcctccctgtgcgagatgctgcagagacgcggtggcgccgtgtcgagctcgctgctggagtccgaccatttcagcaagaagaggagggtcccgaagatggatctcttcgtcgacgattgcgcggcgggcgaagaacagaaggtgttccagttccagggaattgggacggatgcaccggccatgcctcccgtgcttcctgtgaccaatggtgaggcttttgacagggttgagctgagcctggtctccctggagaaactcttccagagagcaaatgatgcttgcacagctgctgaagaaatgtactcccatggtcatggtggtactgaacccagcactgctatatgtcctgaagagatgaacactgctccaatggagacaggcatcgatcttcagttaccagctagcctccatcccagctcacccaacacagggaatgcccatctccatttatccactgaactcacagagtctccaggttttgtgcagagtccagagctgccaatggcagagattcgtgaagatatccatgtgacaagatacccaacacaagctgatgtaaattctgagattgcctcctccactgatacttcacaagatggcacgtcagaaactgaagcttcgcatggaccgaccaacgatgtgttttgggagcggttcctcacagagactccacggtcatgtttggatgagtcagaaagacaagagtctcccaaggacgatgtaaaagcagaattaggctgcaatggcttccatcaccgggagaaggttgatcagatcaccgagcaaatggggcaccttgcttcagccgagcagactctgcatacctga</cdnaseq>

Protein Sequence

<aaseq>MESSNLGGGGGGGGGGGPPPFLIKTYEMVEDAATNHVVSWGPGG ASFVVWNPLDFSRDLLPKYFKHNNFSSFIRQLNTYGFRKIDPERWEFANEDFIRGHTH LLKNIHRRKPVHSHSLQNQINGPLAESERRELEEEINRLKYEKSILVADLQRQNQQQY VINWQMQAMEGRLVAMEQRQKNIVASLCEMLQRRGGAVSSSLLESDHFSKKRRVPKMD LFVDDCAAGEEQKVFQFQGIGTDAPAMPPVLPVTNGEAFDRVELSLVSLEKLFQRAND ACTAAEEMYSHGHGGTEPSTAICPEEMNTAPMETGIDLQLPASLHPSSPNTGNAHLHL STELTESPGFVQSPELPMAEIREDIHVTRYPTQADVNSEIASSTDTSQDGTSETEASH GPTNDVFWERFLTETPRSCLDESERQESPKDDVKAELGCNGFHHREKVDQITEQMGHL ASAEQTLHT</aaseq>

Gene Sequence

<dnaseqindica>601..837#1075..2217#cgccctgcacccgttgccaccaccaccgccttctccgccgcgccgcctcctctcgcgtctcccgctcgtgcagggcgcgcgtcgtcgggcgagctgctgccgtctccgtggccgtggctgatcaggtgagaattgagaaaggttgtgagttttcgcgtggttgtctggttgattcgatcgtgccggcgcgccttggcatggcaggcaagattgtatcaggagataatgaaaaaacatacactgggctttctttttcttaatttctttgcattctttgcttcgacggctatggttgcttgaactgttcaggcggcgcctttgtgtatacacgtgcttgtatgtgatgctctggtcatttctttttgcagaactagttggcgttcgatcggaaagtcgctgtcttttggcgactcggtgagaatttgcgccgcggttcaatgtgaaaaattttggcccgtggcgagttggatttggcgccgagtccattcaggtggttaagacttgttcgtgggagagcgaagctgcgcgcgttaagaccgggctccgttcttgcatcgtgcagagcagctgctggtttgagaattgagaggcgcggttgacatggagagttccaacctgggcggcggcggcggcggaggcggcggcggtgggccgccgccgttcttgatcaagacgtacgagatggtggaggacgcggcgaccaaccacgtcgtgtcgtggggccccggcggcgccagcttcgtcgtgtggaacccgctcgacttctcccgtgacctgttgcccaagtacttcaagcacaacaacttctccagcttcatcaggcagctcaacacctacgtgagtcacaaacacaatcccctttgcttcttgaaacgaaacaaacattgcaacaatcatgtgctactgtttgcttgtaaattagtagttccttgttcttggtttgtttggatgattttaccattgacacagcagccggttttatatagcctatttgattttctgtaaaatagttctttattcttggttggtttgaccgtagctgaattttgacttcaattggcatcttcctttcagggtttccgaaaaatcgatcctgagagatgggagttcgcaaacgaggatttcataagagggcacacgcaccttctgaagaacatccatcgacgcaagcccgtgcacagccactccctccagaaccagataaacggaccactcgccgaatcggagaggcgcgagctcgaagaagagatcaaccggctcaagtacgagaagagcatcctcgtcgcggacctccagaggcagaaccagcagcagtacgtgatcaactggcagatgcaggcgatggaaggcaggctagtggcgatggagcaacggcagaagaacatcgtggcctccctgtgcgagatgctgcagagacgcggtggcgccgtgtcgagctcgctgctggagtccgaccatttcagcaagaagaggagggtcccgaagatggatctcttcgtcgacgattgcgcggcgggcgaagaacagaaggtgttccagttccagggaattgggacggatgcaccggccatgcctcccgtgcttcctgtgaccaatggtgaggcttttgacagggttgagctgagcctggtctccctggagaaactcttccagagagcaaatgatgcttgcacagctgctgaagaaatgtactcccatggtcatggtggtactgaacccagcactgctatatgtcctgaagagatgaacactgctccaatggagacaggcatcgatcttcagttaccagctagcctccatcccagctcacccaacacagggaatgcccatctccatttatccactgaactcacagagtctccaggttttgtgcagagtccagagctgccaatggcagagattcgtgaagatatccatgtgacaagatacccaacacaagctgatgtaaattctgagattgcctcctccactgatacttcacaagatggcacgtcagaaactgaagcttcgcatggaccgaccaacgatgtgttttgggagcggttcctcacagagactccacggtcatgtttggatgagtcagaaagacaagagtctcccaaggacgatgtaaaagcagaattaggctgcaatggcttccatcaccgggagaaggttgatcagatcaccgagcaaatggggcaccttgcttcagccgagcagactctgcatacctgatgcagtaataccatttgcgcggattcatagttcgtgtgtaaattagcgaagatgtaaattatagcttagatcggattagaggcttgcgtgttactttacagatttcaaccttttattagattacaataggtctttcacaatttatgattctgttctatccgctgactactgtgcataaattttttttagtagaccatatccatttttgtactccattgcccttctaagattcctcgttaaaatctc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0530400, RefSeq:Os05g0530400