Difference between revisions of "Os08g0535200"
Bettychenmei (talk | contribs) (→Function) |
Bettychenmei (talk | contribs) (→Function) |
||
| Line 7: | Line 7: | ||
After fine mapping Of xa13 to a 14.8kb DNA fragment.Sequence analysis of this fragment indicate that this region contained two complete open reading frames and the 5’ end of a predicted hypothetical gene.We found two candidate genes, a prime stretch class is rich in protein gene homologous gene proline, and the other is the nodule gene MtN3 homologous gene<ref>Zhang G, E.R. Angeles, M.L.C,et al.RAPD and RFLP mapping of the bacterial blight resistance gene xa-13 in rice.Theoretical and Applied Genetics, 1996, 93(1-2): 65-70</ref>. | After fine mapping Of xa13 to a 14.8kb DNA fragment.Sequence analysis of this fragment indicate that this region contained two complete open reading frames and the 5’ end of a predicted hypothetical gene.We found two candidate genes, a prime stretch class is rich in protein gene homologous gene proline, and the other is the nodule gene MtN3 homologous gene<ref>Zhang G, E.R. Angeles, M.L.C,et al.RAPD and RFLP mapping of the bacterial blight resistance gene xa-13 in rice.Theoretical and Applied Genetics, 1996, 93(1-2): 65-70</ref>. | ||
| − | [[File:图片14.8.png|right|thumb|150px|A contig map covering the xa13 region]]Xoo resistance mediated by xa13 is not caused by this amino acid residue variation, but by alteration of promoter regions that leads to differences in the expression of xa13 and Xa13 in reaction to Xoo infection.<ref name=" | + | [[File:图片14.8.png|right|thumb|150px|A contig map covering the xa13 region]]Xoo resistance mediated by xa13 is not caused by this amino acid residue variation, but by alteration of promoter regions that leads to differences in the expression of xa13 and Xa13 in reaction to Xoo infection.<ref name="foo">Chu ZH, Fu YB,Hong Y, et al.Targeting xa13, a recessive gene for bacterial blight resistance in rice.Theoretical and Applied Genetics, 2006, 112(3): 455-461</ref>. |
Revision as of 15:07, 9 June 2014
Xa13 are Rice recessive resistance genes controlling of rice disease resistance and the reproductive growth .
Contents
Annotated Information
Function
The xa13 gene is fully recessive, conferring resistance only in the homozygous status.This gene specifically confers resistance to the Philippine Xoo race 6(PXO99).Thirty bacterial blight resistance(R) genes (21 dominant genes and 9 recessive gene) in rice have been identified. They are the main sources for the genetic improvement of rice for recessive R genes to XOO. However, xa13 is one of the known recessive R genes.It interacts strongly with other R genes such as xa5, Xa4 and Xa21.But small-scale gene expression studies and pathogen-induced subtractive cDNA library analysis have revealed that some defense-responsive genes activated in xa13-mediated resistance are not involved in resistance that is mediated by dominant R genes(Xa4, Xa10andXa26).These results suggest xa13 functions differently from other R genes.[1].[2].
After fine mapping Of xa13 to a 14.8kb DNA fragment.Sequence analysis of this fragment indicate that this region contained two complete open reading frames and the 5’ end of a predicted hypothetical gene.We found two candidate genes, a prime stretch class is rich in protein gene homologous gene proline, and the other is the nodule gene MtN3 homologous gene[3].
Xoo resistance mediated by xa13 is not caused by this amino acid residue variation, but by alteration of promoter regions that leads to differences in the expression of xa13 and Xa13 in reaction to Xoo infection.[4].
The dominant allele,Xa13, is required for both bacterial growth and pollen development. Promoter mutations in Xa13 cause down regulation of expression during host–pathogen interaction,resulting in the fully recessive xa13 that confers race-specific resistance[5].
Xa13 encodes an indispensable plasma membrane protein of the MtN3/saliva family, which is prevalent in eukaryotes with unknown biochemical function.XA13 protein cooperates with two other proteins, COPT1 and COPT5, to promote removal of copper from xylem vessels, where Xoo multiplies and spreads to cause disease[6]
Chen also found XA13 belongs SWEET family can transport from extracellular glucose within the cell , thus providing nutrients for the bacteria , beneficial bacteria growth and reproduction.
Localization
Xa13 is Located in the long arm of rice the chromosome 8.
Expression
xa13 expression levels in leaves is very low, but the high level of expression in the ear and anther. RNA interference by inhibiting the expression of xa13, enhanced xa13-mediated resistance, indicating that the absence of a dominant allele xa13 bacterial blight resistance is a must[7].
Evolution
The type Ⅲ secretion system (T3SS) effector is considered as one of the key virulence factorsin Xanthomonas oryzae. X. oryzae pv. oryzae and X. oryzae pv. oryzicola cause bacterial leaf blight and bacterial leaf streak in rice, which are important bacterial diseases of rice.
Based on bioinformatic analysis of the bacterial genome and other recent reports, X. oryzae contains at least 28 classes of T3SS effectors, divided into two groups: TAL (transcription activator-like) effectors and non-TAL (non transcription activator-like) effectors.
TAL effectors are secreted through the TTSS and targeted to host nuclei, a process that is mediated by the conserved N-terminal and C-terminal regions, respectively.TAL effectors combined with a specific gene promoter DNA, similar to eukaryotic transcription factor gene expression in plants start to control the physiological and biochemical processes of plants[8].
Labs working on this gene
- National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Hua zhong Agricultural University, Wuhan 430070, China
- Department of Genetics, Development, and Cell Biology, Iowa State University, Ames, Iowa 50011
- National Key Laboratory of Crop Biology ShanDong Provincial, Key Laboratory of Agricultural Microbiology ,Shandong Agricultural University ,Tai an 271018, Shandong
References
- ↑ Chu ZH, Fu YB,Hong Y, et al.Targeting xa13, a recessive gene for bacterial blight resistance in rice.Theoretical and Applied Genetics, 2006, 112(3): 455-461
- ↑ Zhou B,Peng K,Chu Z,et al.The defense responsive genes showing enhance and repressive expression after pathogen infection in rice.Sci China C 45:449-467
- ↑ Zhang G, E.R. Angeles, M.L.C,et al.RAPD and RFLP mapping of the bacterial blight resistance gene xa-13 in rice.Theoretical and Applied Genetics, 1996, 93(1-2): 65-70
- ↑ Chu ZH, Fu YB,Hong Y, et al.Targeting xa13, a recessive gene for bacterial blight resistance in rice.Theoretical and Applied Genetics, 2006, 112(3): 455-461
- ↑ Chu, ZH., Yuan M, Yao J,et al.Promoter Mutations of an Essential Gene for Pollen Development Result in Disease Resistance in Rice." Genes Dev 20, no. 10 (2006): 1250-5.
- ↑ Yuan, M, Chu ZH, Li X,et al.The Bacterial Pathogen Xanthomonas Oryzae Overcomes Rice Defenses by Regulating Host Copper Redistribution. Plant Cell 22, no. 9 (2010): 3164-76.
- ↑ Antony.G, Zhou J, Huang S, et al. Rice Xa13 Recessive Resistance to Bacterial Blight Is Defeated by Induction of the Disease Susceptibility Gene Os-11n3." Plant Cell 22, no. 11 (2010): 3864-76.
- ↑ T. OGAWA, LIN L , R. E. TABIEN .et al.A new recessive gene for resistance to bacterial blight of rice Rice Genetics Newsletters, 1987, 4(0): 98-100
Structured Information
| Gene Name |
Os08g0535200 |
|---|---|
| Description |
Similar to MtN3-like protein |
| Version |
NM_001068889.1 GI:115477516 GeneID:4346153 |
| Length |
2843 bp |
| Definition |
Oryza sativa Japonica Group Os08g0535200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:26813957..26816799 |
| Sequence Coding Region |
26814378..26814713,26814806..26814925,26815020..26815392,26815491..26815527,26816571..26816628 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggaaacatcatctccttcctggtgttccttgcaccagtggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatgtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtga</cdnaseq> |
| Protein Sequence |
<aaseq>MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKST GGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRAR LRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVI KTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRK PRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAA EQAADGVAAAAAADKELLQNKPEVIEITAAV</aaseq> |
| Gene Sequence |
<dnaseqindica>2087..2422#1875..1994#1408..1780#1273..1309#172..229#acacatgcagttgtagtagcacttaagccttcctctctagctagcatctcttgtgtcaggaagttggaagggatttctggctagtttctagctggtgtctcctctcctcttcctaaccttctcactgattaacaccttagagttagttaataaccttcatcaccagtagcaatggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggtaaagcatgcaaccaatgcataatgctcaaacttaatttcatcatcatcatcatcatcatcatcttcacagccatgatcatccatggacaaatgcaactgaagatcattttagttttcatatgctaatgatcaaattcaggttaattgctgtttaatttctccatacactagttgttgtctgcaccattgcattgtgcacagcacacacacgcttttgatgcttctaggaatgcatatctgttcagcagttcacacagtgcagcagggcaatgttgttaaaaaatcttctccttttttttatgtccttgtgttcttgagctttctgtctccattgatctgcttttttcttgtttacaagtgatgggcacaagtcacttccctagcttcagctcatgcatggagcaggaatctcacttcaaaagacctagcactttttctctcttcacctttttgcctcaacacatgcccagtttctggccacacaaacataaacacatatactatctagctgcataattgcatcaaattaagcagggtttgtttcagctaggaattccacacataggtcattaattagtattgccaactttctcaacatgcatgcactctagtactctacctaagctagctcccagattagcttctgctaatttaattccgatttcttgaaatggagatcggttgagcagtgagggaggcgtgcatctgctcctcttcgtcgctgtcactaaacaaaagcagagctagctaggtggtaacaaactgatttgatttttgtcagtaaacaaaaatgaccaattaatgacccatcaaccagtttcaattctcgatcctaacctagctaacatctctgaaactctgaaagaacattactatcttactgacagtgtatatatatgcaaactaaaattttattttattttatcctaacctagctaacatatctgcatccgtgtgaaccagctgaaactctgaaagaatgttactccactgatcatatattaattaacgatgtcgttttctgtcttgtttcttttgcaggaaacatcatctccttcctggtgttccttgcaccagtgtgagtactccattcctactgtcaccatcaaaatctcgagagaaacatctgaatatctctgacgacgaactggaatttatatctctgaaaaattgcagggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcgtaagcttaagctctctaccccccctctacatttcactgacatcaattgcattatgtagctgagcatttctgttgatgatgatgatgcttgcagttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatggtgagctcagctgccgccattgatagagctgctcgacgacgccattgttgtgaattgttttgagctgacttgcatttcttggtgcgatgcagtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtgacgacgactgatctcgacgacgacagattctcgctactgatgaagaagacgacgacgatggccggatcgatgacggacagaatttagcagtgtggattactaccgaactttaattagttggttaattattggattacaatgtggtaagagtgtgtcattagcagctagttaacttacttaaattaattatcttgttcagtcagtcagtcagtcagtcagtcagtcagctttgagtgagtgagtgagtgatctcgacgtagtttgctggttggtgtaataagaaaaaggcgatctactagtagtctactagctagtacgcatgcatgtgtgtgtgctctacttaccgtgttgcaatctcatctctttgtacttacaactcagaaatcaatggaagattgtgacaggtattattagtagttact</dnaseqindica> |
| External Link(s) |