Difference between revisions of "Os06g0127800"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 17: Line 17:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research
 
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research
Institute of Genetics and Developmental Biology
 
  
 
==References==
 
==References==

Revision as of 15:09, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

DLT,a GRAS protein,was identified to be involved in rice BR signaling.The brassinosteroid (BR) response is fine-tuned by multiple strategies.Transcription analysis of most known BR-related genes, including biosynthetic genes, signaling genes and also several downstream BR responsive genes, reveals DLT has extensive effects on BR-related genes expression, indicating its important role in modulating BR response. By promoter and protein sequence analysis, a complicated and subtle network was proposed that DLT may be involved in fine-modulating BR response at both transcriptional and protein levels.Function of DLT seems very similar to OsBZR1.Both of them play dual roles in mediating upstream signaling to activate downstream gene expression, and in addition inhibiting the expression of BR biosynthetic genes.This gives out the possibility that DLT may interact with OsBZR1 directly to form protein complex to execute their regulatory functions. However,yeast two-hybrid tests disaffirmed this presumption. It is interesting that three BRREs (BR-Response Elements) and two E-boxes were found in DLT promoter, implying the role of DLT as the potential target of OsBZR1 which could possibly both repress and activate its transcription.Our data also suggest that DLT and OsBZR1 regulate each other in opposite ways: while OzBZR1 binds to DLT promoter to inhibit its expression, DLT seems to promote OsBZR1 expression, indicating that the complex regulatory network may be necessary for the fine-tuning of BR response.

Expression

overexpression of a positive signaling gene, DLT, leads to confused phenotype, with either slightly higher or even shorter than wild-type, implying the insensitivity to a certain extent of rice cell elongation/division to alteration of endogenous BR level. It was believed that rice adopts a subtle and complicated mechanism to fine-tune the plant response to BR, either exogenous or endogenous.

Evolution

At transcriptional level, mediating through DLT and OsBZR1, BR response can feedback-regulate both the BR biosynthetic gene expression and BR signaling gene expression. While at the same time, DLT and OsBZR1 themselves are regulated each other. This compensation mechanism used to balance the BR response may partially explain that the change folds of the whole genome gene expression caused by BR deficiency or BR treatment are comparably very modest, as indicated by several microarray tests in Arabidopsis,which is quite different from observed in other phytohormone treatments. With respect to protein level, DLT could be phosphorylated, subcellular transported, interacted with other proteins or degraded,11 representing multiple strategies for hormone signaling. The subtle network may provide some cues for the tricky response of rice to increased exogenous or endogenous BR level. Whatever is true or not, this deduction provides new insights into BR signaling pathway in rice, and also direct our further efforts to testify this hypothesis to finally uncover the underlying mechanism of rice fine modulation on BR response.

Labs working on this gene

State Key Laboratory of Plant Genomics and National Center for Plant Gene Research

References

Please input cited references here.

Structured Information

Gene Name

Os06g0127800

Description

GRAS transcription factor domain containing protein

Version

NM_001063202.1 GI:115466135 GeneID:4339980

Length

3084 bp

Definition

Oryza sativa Japonica Group Os06g0127800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:1464501..1467584

Sequence Coding Region

1464961..1466814

Expression

GEO Profiles:Os06g0127800

Genome Context

<gbrowseImage1> name=NC_008399:1464501..1467584 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:1464501..1467584 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgttggcgggttgctcgttctcgtcgtcgaggcatcagatgagcaccgcgcagcgtttcgacatcctcccctgcggcttctccaagcgcggcagccgcggcgacggcgccgccccgcgggtcgccggcgacgccaggagcggcgccaccacctgctccttccggacgcaccccgcgccgccggtcacccagtccgtgtcctggggcgccaagccggagcccggcggcaatggcaatggcgcccaccgcgccgttaagcgggcgcatgacgaggacgcggtcgaggagtatggccccattgttcgcgccaagcggacgcggatgggcggcgacggcgatgaggtatggttccatcaatccattgcagggacgatgcaagcgacggcggcgggagaaggagaggaggcggaggaggagaaggtcttcttggtgccgagcgcggcggcgttcccgcacggcatggccgccgcggggccatcgctggccgcggccaagaaggaggagtacagcaagtcgccgtccgactcgtcgtcctcgtcgggcacggacggcggctcgtcggcgatgatgccgccgccgcagccgcccgagttcgacgcgaggaacggcgtgccggcgccggggcaggcggagcgggaggcgctggagctggtgcgcgcgctcaccgcgtgcgccgactccctctccgccggcaaccacgaggccgccaactactacctggcccggctcggcgagatggcctcgccggcggggcccacgccgatgcaccgcgtggccgcctacttcaccgaggcgctcgcgctccgcgtcgtgcgcatgtggccgcacatgttcgacatcggcccgccgcgggagctcaccgacgacgccttcggcggcggcgacgacgacgccatggcgctgcggatactcaacgccatcacgcccatcccgaggttcctgcacttcacgctcaacgagcgcctcctccgcgagttcgaggggcacgagcgcgtccacgtcatcgacttcgacatcaagcaggggctccaatggccgggcttgctccagagcctggccgcgcgggcggtgcctccggcgcacgtgcggatcaccggagtcggcgagtcgaggcaggagctgcaggagacgggagcgcggctggcgcgcgtcgccgccgcgctcggcctggcgttcgagttccacgccgtggtcgaccggctcgaggacgtccgcctgtggatgctccacgtcaagcgcggcgagtgcgtggccgtgaactgcgtcctcgccatgcaccgcctgctccgcgacgacgccgcgctgaccgacttcctggggctagcgcgcagcacgggcgccaccatcctcctcctcggcgagcacgagggcggcggcctcaactcggggaggtgggaggcgcggttcgcgcgcgcgctgcggtactacgccgcggcgttcgacgcggtggacgcggcggggctgccggaggcgagccccgcgagggccaaggcggaggagatgttcgcgcgggagatccgcaacgcggtggcgttcgagggccccgagcggttcgagcgccacgagagcttcgccgggtggcggcggcgcatggaggacggcggcgggttcaagaacgccggcatcggcgagcgcgaggcgatgcaggggcgcatgatcgcgaggatgttcgggccggacaagtacaccgtgcaggcgcacggcggcggcggcagcggcggcggcgaggcgctcacgctccggtggctggaccagccgctgtacaccgtgacggcgtggacgccggcgggcgacggcgcgggaggcagcaccgtgtcggcgtccacaacagcatcacattctcagcaaagctaa</cdnaseq>

Protein Sequence

<aaseq>MLAGCSFSSSRHQMSTAQRFDILPCGFSKRGSRGDGAAPRVAGD ARSGATTCSFRTHPAPPVTQSVSWGAKPEPGGNGNGAHRAVKRAHDEDAVEEYGPIVR AKRTRMGGDGDEVWFHQSIAGTMQATAAGEGEEAEEEKVFLVPSAAAFPHGMAAAGPS LAAAKKEEYSKSPSDSSSSSGTDGGSSAMMPPPQPPEFDARNGVPAPGQAEREALELV RALTACADSLSAGNHEAANYYLARLGEMASPAGPTPMHRVAAYFTEALALRVVRMWPH MFDIGPPRELTDDAFGGGDDDAMALRILNAITPIPRFLHFTLNERLLREFEGHERVHV IDFDIKQGLQWPGLLQSLAARAVPPAHVRITGVGESRQELQETGARLARVAAALGLAF EFHAVVDRLEDVRLWMLHVKRGECVAVNCVLAMHRLLRDDAALTDFLGLARSTGATIL LLGEHEGGGLNSGRWEARFARALRYYAAAFDAVDAAGLPEASPARAKAEEMFAREIRN AVAFEGPERFERHESFAGWRRRMEDGGGFKNAGIGEREAMQGRMIARMFGPDKYTVQA HGGGGSGGGEALTLRWLDQPLYTVTAWTPAGDGAGGSTVSASTTASHSQQS</aaseq>

Gene Sequence

<dnaseqindica>771..2624#gagtgagagtgagagagtgagagcagagaccaccaccaccggagaggttagtgagagaggagtggtaatggtgaggcaacaagagtaggttccatttcatatcatcactaggatagcgtagtttgtaggctgcatctccatctccatcgccattgattcgcattgcatccatcattttaggatgttctactagggttcttgatttttcttttggtttgttgttttgacgaatggaggtattgttgggattcgccgcctgctgctcgtcgtcgtcgtcgccgatgaggaggccgtgcgggctctgccccggcatgtccgatcgttcgtgatttgttttttctacatgttttagggcccatttgttcttgatcctattctttgattcttttgtactaagcattctaaggcgaagccacccattctttcctgcatatatacttacaaacacatagcccccatctgatctcacaaacattatttctctctctttttttctcagttttttctttgttgatttactgaccaaattctttggaagaacaacaagatcatctggtttttatctgctcattcttttgtacatcgaatcatatacatttccattccaccaaagccttagccagataccacagagagagtgtgagagaaatcagagtgagaaacagaggaggaagaagaagaagaagacgaggaggaggaggaggaggagcaggaggaggaggaggtctcttcttggcacgtcgcgttccggcgagtgacgtgtctccgggatgttggcgggttgctcgttctcgtcgtcgaggcatcagatgagcaccgcgcagcgtttcgacatcctcccctgcggcttctccaagcgcggcagccgcggcgacggcgccgccccgcgggtcgccggcgacgccaggagcggcgccaccacctgctccttccggacgcaccccgcgccgccggtcacccagtccgtgtcctggggcgccaagccggagcccggcggcaatggcaatggcgcccaccgcgccgttaagcgggcgcatgacgaggacgcggtcgaggagtatggccccattgttcgcgccaagcggacgcggatgggcggcgacggcgatgaggtatggttccatcaatccattgcagggacgatgcaagcgacggcggcgggagaaggagaggaggcggaggaggagaaggtcttcttggtgccgagcgcggcggcgttcccgcacggcatggccgccgcggggccatcgctggccgcggccaagaaggaggagtacagcaagtcgccgtccgactcgtcgtcctcgtcgggcacggacggcggctcgtcggcgatgatgccgccgccgcagccgcccgagttcgacgcgaggaacggcgtgccggcgccggggcaggcggagcgggaggcgctggagctggtgcgcgcgctcaccgcgtgcgccgactccctctccgccggcaaccacgaggccgccaactactacctggcccggctcggcgagatggcctcgccggcggggcccacgccgatgcaccgcgtggccgcctacttcaccgaggcgctcgcgctccgcgtcgtgcgcatgtggccgcacatgttcgacatcggcccgccgcgggagctcaccgacgacgccttcggcggcggcgacgacgacgccatggcgctgcggatactcaacgccatcacgcccatcccgaggttcctgcacttcacgctcaacgagcgcctcctccgcgagttcgaggggcacgagcgcgtccacgtcatcgacttcgacatcaagcaggggctccaatggccgggcttgctccagagcctggccgcgcgggcggtgcctccggcgcacgtgcggatcaccggagtcggcgagtcgaggcaggagctgcaggagacgggagcgcggctggcgcgcgtcgccgccgcgctcggcctggcgttcgagttccacgccgtggtcgaccggctcgaggacgtccgcctgtggatgctccacgtcaagcgcggcgagtgcgtggccgtgaactgcgtcctcgccatgcaccgcctgctccgcgacgacgccgcgctgaccgacttcctggggctagcgcgcagcacgggcgccaccatcctcctcctcggcgagcacgagggcggcggcctcaactcggggaggtgggaggcgcggttcgcgcgcgcgctgcggtactacgccgcggcgttcgacgcggtggacgcggcggggctgccggaggcgagccccgcgagggccaaggcggaggagatgttcgcgcgggagatccgcaacgcggtggcgttcgagggccccgagcggttcgagcgccacgagagcttcgccgggtggcggcggcgcatggaggacggcggcgggttcaagaacgccggcatcggcgagcgcgaggcgatgcaggggcgcatgatcgcgaggatgttcgggccggacaagtacaccgtgcaggcgcacggcggcggcggcagcggcggcggcgaggcgctcacgctccggtggctggaccagccgctgtacaccgtgacggcgtggacgccggcgggcgacggcgcgggaggcagcaccgtgtcggcgtccacaacagcatcacattctcagcaaagctaagctgacgatgaatggtgattaggtgaagagaaagaaagaacaaagcctttttttacagtgcttcttttgttaatgatgattagttcatacagtatgacaattcttttatacattcagagaaaagaaagaagaaagaaaggtgtagttttttgttttatagattgataggtggaaagattcaattaaatcaaattcaattcaatttttagattgtaattctttataaatattcttttggctgttgagagagagtcccctgcaaaatgtagctgcatgtagaagaaagaaagcaaagaagcagtagatagattagcaggggcagcatctctcacagtcactattagtgtctccggctgttattatacaacattattattacaatcaaattctttcatcattcattctacatgtaatctctgttcagaatcagaatgaaatgaaacatgtgttatatttctcc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0127800, RefSeq:Os06g0127800