Difference between revisions of "Os02g0620600"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 13: Line 13:
 
# Ammonium showed positive effects on the expression of OsAMT1;2. These effects were mimicked not only by glutamine but also by asparagines. On the other hand.
 
# Ammonium showed positive effects on the expression of OsAMT1;2. These effects were mimicked not only by glutamine but also by asparagines. On the other hand.
 
# Glutamate and aspartate were ineffective with respect to OsAMT1;2.('''Figure 1''').<ref name="ref4" />[[File:LIZHAO.png‎|frame|'''Figure 1'''Hypothetical model of the regulation of OsAMT1 genes in rice roots.]]
 
# Glutamate and aspartate were ineffective with respect to OsAMT1;2.('''Figure 1''').<ref name="ref4" />[[File:LIZHAO.png‎|frame|'''Figure 1'''Hypothetical model of the regulation of OsAMT1 genes in rice roots.]]
while OsAMT1;1 was constitutively expressed (Figs. 2 and 3), accumulation of OsAMT1;2 transcripts was roots-specific and ammonium-inducible (Figs. 2 and 3).<ref name="ref2" />
+
while OsAMT1;1 was constitutively expressed (Figs. 2 and 3), accumulation of OsAMT1;2 transcripts was roots-specific and ammonium-inducible (Figs. 2 ).<ref name="ref2" />[[File:LIZHAO.png‎|frame|'''Figure 1'''while OsAMT1;1 was constitutively expressed (Figs. 2 and 3), accumulation of OsAMT1;2 transcripts was roots-specific and ammonium-inducible (Figs. 2 and 3).]]
  
 
===Evolution===
 
===Evolution===

Revision as of 15:15, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

  1. AmmoniAmmonium transporter probably involved in ammonium uptake from the soil and ammonium uptake and retrieval in the vascular system.um transporter probably involved in ammonium uptake from the soil and ammonium uptake and retrieval in the vascular system.[1]
  2. OsAMT1;2(Os02g0620500)is one of the OsAMT1 family members which contain three genes(OsAMT1;1,OsAMT1;2 and OsAMT1;3). OsAMT1s belong to AMT1 family, containing 11 putative trans-membrane-spanning domains. Southern blot analysis and screening of the rice genome database confirmed that with OsAMT1;1–1;3the complete AMT1 family of rice had been isolated. [2]
  3. The amino acid sequences of the OsAMT1;1, OsAMT1;2 and OsAMT1;3 share high sequence similarity to each other and to other AMT1-type ammonium transporters previously identified from other plant species. All three isolated OsAMT1 genes encode functional ammonium transporters.Northern blot analysis showed a distinct expression pattern for the three genes; more constitutive expression in shoots and roots for OsAMT1;1, root-specific and ammonium-inducible expression for OsAMT1;2, and root-specific and nitrogen-derepressible expression for OsAMT1;3.
  4. OsAMT1;2 has ammonium transporters activity and mediates ammonium uptake from the soil solution. [3]

Expression

  1. OsAMT1;2 is expressed in the central cylinder and cell surface of root tips.
  2. OsAMT1;2 expression was root specific and ammonium inducible.
  3. Ammonium showed positive effects on the expression of OsAMT1;2. These effects were mimicked not only by glutamine but also by asparagines. On the other hand.
  4. Glutamate and aspartate were ineffective with respect to OsAMT1;2.(Figure 1).[4]
    Figure 1Hypothetical model of the regulation of OsAMT1 genes in rice roots.
while OsAMT1;1 was constitutively expressed (Figs. 2 and 3), accumulation of OsAMT1;2 transcripts was roots-specific and ammonium-inducible (Figs. 2 ).[2]
Figure 1while OsAMT1;1 was constitutively expressed (Figs. 2 and 3), accumulation of OsAMT1;2 transcripts was roots-specific and ammonium-inducible (Figs. 2 and 3).

Evolution

  1. OsAMT1;2(Os02g0620500)is one of the OsAMT1 family members which contain three genes(OsAMT1;1,OsAMT1;2 and OsAMT1;3). OsAMT1s belong to AMT1 family, containing 11 putative trans-membrane-spanning domains. (Figure4).[4]

[[File:LIZHAO.jpg‎|frame|Figure4Localization of OsAMT1;2mRNA in rice root tip by in situ hybridization.

  1. Hydropathy analysis of the deduced amino acid sequence suggests that OsAMT1;1 and OsAMT1;2 contain 10-11 putative trans-membrane domains. Sequence comparison shows that OsAMT1;1 and OsAMT1;2 are closely related to Arabidopsis and tomato ammonium transporters (67-63%,). (Figure5).[5]

[[File:LIZHAO.jpg‎|frame|Figure5

Labs working on this gene

  1. BioScience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, 464-8601 Japan
  2. State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, Nanjing 210008 (China)
  3. Key Laboratory of Agro-ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences,Hunan 410125 (China)
  4. Department of Botany, the University of British Columbia, Vancouver, BC, Canada
  5. Agriculture and AgriFood Canada, Shelterbelt Centre Indian Head SK, Canada
  6. Division of Biology, University of California at San Diego, La Jolla, CA 92093–0116, USA
  7. Division of Biological Sciences, Graduate School of Science, Hokkaido University, Kita-ku N10-W8, Sapporo, 060-0810 Japan
  8. CREST, Japan Science and Technology Corporation (JST)CREST, Japan Science and Technology Corporation (JST)
  9. Division of Bioresources and Product Science, Graduate School of Agriculture, Hokkaido University, Kita-ku N9-W9, Sapporo, 060-8589 Japan
  10. Plant Science Center, RIKEN, 1-7-22 Suehiro, Tsurumi-ku, Yokohama, 230-0045 Japan

References

Please input cited references here.

Structured Information

Gene Name

Os02g0620600

Description

Ammonium transporter family protein

Version

NM_001053991.1 GI:115447352 GeneID:4330008

Length

1853 bp

Definition

Oryza sativa Japonica Group Os02g0620600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:25548745..25550597

Sequence Coding Region

25548816..25550306

Expression

GEO Profiles:Os02g0620600

Genome Context

<gbrowseImage1> name=NC_008395:25548745..25550597 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:25548745..25550597 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcaacgtgcgcggataccctcggcccgctgctgggcacggcggcggcgaacgcgacggactacctgtgcaaccagttcgcggacacgacgtcggccgtggactcgacgtacctgctcttctcggcgtacctcgtgttcgccatgcagctcggcttcgccatgctctgcgccgggtccgtccgcgccaagaacaccatgaacatcatgcttaccaacgtgctcgacgccgccgccggcgcgctcttctactacctcttcggcttcgccttcgccttcggggcgccgtccaacggcttcatcgggaagcacttcttcggcctcaagcaggtcccacaggtcggcttcgactacagcttcttcctcttccagtgggccttcgccatcgccgccgcgggcatcacgtccggctccatcgccgagcggacccagttcgtggcgtacctcatctactccgccttcctcaccggcttcgtctacccggtggtgtcccactggatctggtccgccgacgggtgggcctcggcttcccggacgtcggggtcgctgctcttcgggtccggcgtcatcgacttcgccgggtcaggggttgtccacatggtgggcggcgtggccggactctggggcgccctcatcgagggcccccgcattgggcggttcgaccacgccggccgctcggtggcgctgcgcggccacagcgcgtcgctcgtcgtgctcggcagcttccttctgtggttcgggtggtacgggtttaaccccggctcgttcctcaccatcctcaaatcctacggcccgcccggtagcatccacgggcagtggtcggcggtgggacgcaccgccgtgaccaccaccctcgccggcagcacggcggcgctcacgacgctcttcgggaagaggctccagacggggcactggaacgtgatcgacgtctgcaacggcctcctcggcggcttcgcggcgatcaccgccggttgctccgtcgtcgacccgtgggccgcgatcatctgcgggttcgtctcggcgtgggtgctcatcggcctcaacgcgctggcggcgaggctcaagttcgacgacccgctcgaggcggcgcagctgcacggcgggtgcggcgcgtggggggtcatcttcacggcgctgttcgcgcgcaaggagtacgtggaccagatcttcggccagcccgggcgcccgtacgggctgttcatgggcggcggcggccggctgctcggggcgcacatagtggtcatcctggtcatcgcggcgtgggtgagcttcaccatggcgccgctgttcctggtgctcaacaagctgggcttgctgcgcatctcggccgaggacgagatggccggcatggaccagacgcgccacggcgggttcgcgtacgcgtaccacgacgacgacgcgagcggcaagccggaccgcagcgtcggcgggttcatgctcaagtcggcgcacggcacgcaggtcgccgccgagatgggaggccatgtctag</cdnaseq>

Protein Sequence

<aaseq>MATCADTLGPLLGTAAANATDYLCNQFADTTSAVDSTYLLFSAY LVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGALFYYLFGFAFAFGAPSNGFIG KHFFGLKQVPQVGFDYSFFLFQWAFAIAAAGITSGSIAERTQFVAYLIYSAFLTGFVY PVVSHWIWSADGWASASRTSGSLLFGSGVIDFAGSGVVHMVGGVAGLWGALIEGPRIG RFDHAGRSVALRGHSASLVVLGSFLLWFGWYGFNPGSFLTILKSYGPPGSIHGQWSAV GRTAVTTTLAGSTAALTTLFGKRLQTGHWNVIDVCNGLLGGFAAITAGCSVVDPWAAI ICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGVIFTALFARKEYVDQIFGQ PGRPYGLFMGGGGRLLGAHIVVILVIAAWVSFTMAPLFLVLNKLGLLRISAEDEMAGM DQTRHGGFAYAYHDDDASGKPDRSVGGFMLKSAHGTQVAAEMGGHV</aaseq>

Gene Sequence

<dnaseqindica>72..1562#acagcccacacttccattgctcctcccctctcctctacagtctgtgttgagcgcgcgtcgaggcggcgaggatggcaacgtgcgcggataccctcggcccgctgctgggcacggcggcggcgaacgcgacggactacctgtgcaaccagttcgcggacacgacgtcggccgtggactcgacgtacctgctcttctcggcgtacctcgtgttcgccatgcagctcggcttcgccatgctctgcgccgggtccgtccgcgccaagaacaccatgaacatcatgcttaccaacgtgctcgacgccgccgccggcgcgctcttctactacctcttcggcttcgccttcgccttcggggcgccgtccaacggcttcatcgggaagcacttcttcggcctcaagcaggtcccacaggtcggcttcgactacagcttcttcctcttccagtgggccttcgccatcgccgccgcgggcatcacgtccggctccatcgccgagcggacccagttcgtggcgtacctcatctactccgccttcctcaccggcttcgtctacccggtggtgtcccactggatctggtccgccgacgggtgggcctcggcttcccggacgtcggggtcgctgctcttcgggtccggcgtcatcgacttcgccgggtcaggggttgtccacatggtgggcggcgtggccggactctggggcgccctcatcgagggcccccgcattgggcggttcgaccacgccggccgctcggtggcgctgcgcggccacagcgcgtcgctcgtcgtgctcggcagcttccttctgtggttcgggtggtacgggtttaaccccggctcgttcctcaccatcctcaaatcctacggcccgcccggtagcatccacgggcagtggtcggcggtgggacgcaccgccgtgaccaccaccctcgccggcagcacggcggcgctcacgacgctcttcgggaagaggctccagacggggcactggaacgtgatcgacgtctgcaacggcctcctcggcggcttcgcggcgatcaccgccggttgctccgtcgtcgacccgtgggccgcgatcatctgcgggttcgtctcggcgtgggtgctcatcggcctcaacgcgctggcggcgaggctcaagttcgacgacccgctcgaggcggcgcagctgcacggcgggtgcggcgcgtggggggtcatcttcacggcgctgttcgcgcgcaaggagtacgtggaccagatcttcggccagcccgggcgcccgtacgggctgttcatgggcggcggcggccggctgctcggggcgcacatagtggtcatcctggtcatcgcggcgtgggtgagcttcaccatggcgccgctgttcctggtgctcaacaagctgggcttgctgcgcatctcggccgaggacgagatggccggcatggaccagacgcgccacggcgggttcgcgtacgcgtaccacgacgacgacgcgagcggcaagccggaccgcagcgtcggcgggttcatgctcaagtcggcgcacggcacgcaggtcgccgccgagatgggaggccatgtctagtggaaccggaggagctgagctagtagtacatacatgcagcatcatcgatcgaacgaaatgcatataagcgtttttcaaggttgatctgatgctgcaggtttcgtgattgtataataggaagaaaaagatagtagtattttttatctgagatcatctgtttggaacaggggatttgactaagatttgatataaatttacacaaaatcttagcaaaaatccctttatctcaactctcaagtagagctttgctttgtacaacaaagtatcatgtgtgatataattgtcaggtgg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0620600, RefSeq:Os02g0620600

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5