Difference between revisions of "Os03g0224700"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
 
 +
    It belongs to Heat stress transcription factors (Hsfs),Heat stress transcription factors (Hsfs) are the central regulators of defense response to heat stress.Hsfs diversify in their biological functions (Kotak etal., 2007b; von Koskull-Döring et al., 2007). HsfA members are capable of transcriptional activation,while HsfB members act as repressors or as co-activators (e.g., HsfB1) of HsfA members (Bharti et al., 2004; Czarnecka-Verner et al., 2004). However,AtHsfA4 activity was reported to be repressed by AtHsf5, which belongs to class A Hsfs (Baniwal etal., 2007). Overexpression of Hsf genes in transgenic
 +
plants resulted in an up-regulation of heatstress-associated genes and an enhancement of thermotolerance, whereas the down-regulation of Hsf genes leads to a reduction in the thermotolerance(Charng et al., 2007; Mishra et al., 2002; Schramm et al., 2008).
 +
    AtHsfA9 is involved in seed development and controlled by seed-specific transcription factor abscisic acid-insensitive 3 (ABI3) (Kotak etal.,2007a).Further studies to elucidate the functions of the other members in the subfamily may also have potential for the development of transgenic plants with improved stress tolerance.
  
 
===Expression===
 
===Expression===

Revision as of 15:16, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

   It belongs to Heat stress transcription factors (Hsfs),Heat stress transcription factors (Hsfs) are the central regulators of defense response to heat stress.Hsfs diversify in their biological functions (Kotak etal., 2007b; von Koskull-Döring et al., 2007). HsfA members are capable of transcriptional activation,while HsfB members act as repressors or as co-activators (e.g., HsfB1) of HsfA members (Bharti et al., 2004; Czarnecka-Verner et al., 2004). However,AtHsfA4 activity was reported to be repressed by AtHsf5, which belongs to class A Hsfs (Baniwal etal., 2007). Overexpression of Hsf genes in transgenic

plants resulted in an up-regulation of heatstress-associated genes and an enhancement of thermotolerance, whereas the down-regulation of Hsf genes leads to a reduction in the thermotolerance(Charng et al., 2007; Mishra et al., 2002; Schramm et al., 2008).

   AtHsfA9 is involved in seed development and controlled by seed-specific transcription factor abscisic acid-insensitive 3 (ABI3) (Kotak etal.,2007a).Further studies to elucidate the functions of the other members in the subfamily may also have potential for the development of transgenic plants with improved stress tolerance.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0224700

Description

Similar to HSP protein (Fragment)

Version

NM_001055964.1 GI:115451656 GeneID:4332113

Length

3809 bp

Definition

Oryza sativa Japonica Group Os03g0224700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:6564909..6568717

Sequence Coding Region

6565073..6565396,6566628..6567513,6567990..6568012

Expression

GEO Profiles:Os03g0224700

Genome Context

<gbrowseImage1> name=NC_008396:6564909..6568717 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:6564909..6568717 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggctctaagaagcggtcgcctcagcatccggccgccgcggcgccccctcccgccgtcggcggcggcggcggcggcgaggtctccggcgatggtggcgcctcgacggcgaacgggccggtggtgccgaagccgtcggaggtggcgccgttcctgacgaaggtgtacgacatggtctcggaccccgcgaccgacaacgttatctcgtgggccgagggcggcggcagcttcgtgatctgggactcgcacgccttcgagcgcgacctccacaggcacttcaagcacagcaatttcaccagcttcatacgccagctcaacacctatggatttcgtaaagttcaccctgatagatgggagtgggccaatgaaggttttattatgggccaaaaacatcttctgaagaccattaagaggaggaagaagtcttctcaggaatcacctagcgagatacagaaggcgcctgtcaaaactgcacctggtactgaaaatattgagataggaaaatatggtggccttgaaaaggaggttgaaacccttaagagggataaagctcttctcatgcagcagcttgtagatctcaggcactaccagcaaacatctaaccttgaagtgcagaatttaattgaacggcttcaagtaatggaacagaaccagcagcagatgatggcacttctagcaatcgttgtccagaatcctagttttctcaaccagcttgtgcagcaacagcagcagcagcgcagatccaactggtggagtcctgatggaagcaagaaaaggagatttcatgctcttgagcagggccctgtaactgatcaggagacctctggccgtggggcacatattgttgaatatctcccacctgtcccagaaacatcaggtcaagtaaatccagtggaaggagccatttgttcggccaactcacaaccagttccaagtcctgcagttgccacacccatggacatgcaaacgtctaacgttgctgatactctcggttcatctgaggagcctttcgctgataactctactctacatgaatgggatgataacgacatgcagcttctgtttgatgataacctagacccaatacttccaccatttgagaatgatggtcaaatgggccctcctttgagtgttcaagattatgattttccgcagttagagcaggattgtctgatggaagcacaatataactccaacaatcctcaatatgctgatgtcattaccgaagcttga</cdnaseq>

Protein Sequence

<aaseq>MGSKKRSPQHPAAAAPPPAVGGGGGGEVSGDGGASTANGPVVPK PSEVAPFLTKVYDMVSDPATDNVISWAEGGGSFVIWDSHAFERDLHRHFKHSNFTSFI RQLNTYGFRKVHPDRWEWANEGFIMGQKHLLKTIKRRKKSSQESPSEIQKAPVKTAPG TENIEIGKYGGLEKEVETLKRDKALLMQQLVDLRHYQQTSNLEVQNLIERLQVMEQNQ QQMMALLAIVVQNPSFLNQLVQQQQQQRRSNWWSPDGSKKRRFHALEQGPVTDQETSG RGAHIVEYLPPVPETSGQVNPVEGAICSANSQPVPSPAVATPMDMQTSNVADTLGSSE EPFADNSTLHEWDDNDMQLLFDDNLDPILPPFENDGQMGPPLSVQDYDFPQLEQDCLM EAQYNSNNPQYADVITEA</aaseq>

Gene Sequence

<dnaseqindica>165..488#1720..2605#3082..3104#ctagtacaccagacgacaacacacacacaaaaaaaaaaaagaagagaaaaaccgaacgaaaatcccctcgcgcagacgactactacatccttctcgtctcatcccgtcgacccgccgccgcctcaatctcgaagcctcggcgaggctagggtttctgcgtctccatgggctctaagaagcggtcgcctcagcatccggccgccgcggcgccccctcccgccgtcggcggcggcggcggcggcgaggtctccggcgatggtggcgcctcgacggcgaacgggccggtggtgccgaagccgtcggaggtggcgccgttcctgacgaaggtgtacgacatggtctcggaccccgcgaccgacaacgttatctcgtgggccgagggcggcggcagcttcgtgatctgggactcgcacgccttcgagcgcgacctccacaggcacttcaagcacagcaatttcaccagcttcatacgccagctcaacacctatgtgagattcccttgatccctgtgttcgtttgtttctgatgcgcgaattcggtgccatttccagttggttggacgaaatcggtagtgaaatctgagtttctgttcccaatttgttgtttattatcacggctagacagcaaatcttgcttgcaattataaattgggcagtagcttccgatgcactgcatatgaatttgtttgaatcgtgactgcgtgttatatgatgttactttcttctattttgtgccttttaagttgattgcgtgtattagggattatctgccattttggagttaatcacttattaaattttaactacgttggaagctgttggcgatatagttggatgcctttcttcttctagtcgaaagacacaatagaactagtttctgcggtggctttctattcaacaacaacttctagagttctagtacataaaacacgtcattgggggtggggactaatattgttaattttgagaccagtttctgttctcttaatgttttgtgaatttgatcgtatgaaagctggctgtagaaactatgccaaactcttggctttaaattacaggggaatgatatgtgttgcctatcactacttctaaaagtctatttcccccatatttgtatttagtgaacttcagaactagagaaagcatgatgttataacctaccatcatgctgtataagaagaatatgttccctcttgtttggctgaaagaaatgcatgtttggttgtgctgatattgtactgctattatcttcttctgtgtcatttgcctcaatacattgttttatttgaatttgaacttccttttcacaatcgaatttgtctgatgaaatataagattatgaatttgctcttttattgaactatatggacacttaattttgtgcttttggcaaatccatgtcctcattttgatttctggataaatcactggactcttgcacccaggatttcttctgatgtctaattacttaaatgcgaaaatcacctgacttttgctcactgggttgctttcctgtagttaggagtagttctatttaaccatctattagttgttcttggcttcatatactcagtaaaacttaaaaacaaagcctgaaaagtgaaatctccaatgggatcagtagaaacattactttatctgctttcattgatgttctctattcttttggagcatatgttttatattagctgaagttactcaagtttcctttcataatcagggatttcgtaaagttcaccctgatagatgggagtgggccaatgaaggttttattatgggccaaaaacatcttctgaagaccattaagaggaggaagaagtcttctcaggaatcacctagcgagatacagaaggcgcctgtcaaaactgcacctggtactgaaaatattgagataggaaaatatggtggccttgaaaaggaggttgaaacccttaagagggataaagctcttctcatgcagcagcttgtagatctcaggcactaccagcaaacatctaaccttgaagtgcagaatttaattgaacggcttcaagtaatggaacagaaccagcagcagatgatggcacttctagcaatcgttgtccagaatcctagttttctcaaccagcttgtgcagcaacagcagcagcagcgcagatccaactggtggagtcctgatggaagcaagaaaaggagatttcatgctcttgagcagggccctgtaactgatcaggagacctctggccgtggggcacatattgttgaatatctcccacctgtcccagaaacatcaggtcaagtaaatccagtggaaggagccatttgttcggccaactcacaaccagttccaagtcctgcagttgccacacccatggacatgcaaacgtctaacgttgctgatactctcggttcatctgaggagcctttcgctgataactctactctacatgaatgggatgataacgacatgcagcttctgtttgatgataacctagacccaatacttccaccatttgagaatgatggtcaaatgggccctcctttgagtgttcaagattatgattttccgcagttagagcaggattgtctgatggaagcacaatataactccaacaatcctcaatatggtaatgactaattactgtataccctatgtttttgttcatcattttgtggaaaacaagcgtgatgtcattttagttaactgtggagtttctatgtgcatgtttcatgccaaatgccaaacaatggatgtttacagaccacccttttagtctgttgtgctaggatttggcaaagatgacatggagccttattcaaagttcaatacttgcttctcaaatggctttgatatttccttctgttatttcacgaaagtagtgtttgacaactagagtgatatttttttttatatctggttaattggacaattttgatcacagccaaacctcttgatttagtttcctcaaccaaaacagatctaagctgtgcctgcgtcacattgattattttcccaatcagcctattctttgtttgatcatatcggtttcaattcactctgcagtacttctatacatgcctgacatcttccctttttcatcagctgatgtcattaccgaagcttgattggtggtccaggagcatacttgcagtaacattaggtgggtacagtccatttttaacatgaaaaaggaattattccttaatgtgctttgttaatggaatgcttactttgcgttgcaataccaaagtaccaaactgaaagacataccatccttgtttaattcctctagccgttgtttcttacagaactttaggctagtatttcgtgtcaggctaggactatatggtcaactaaccctgcaaccgcctccaaattgaaattcaatcgaaaaaatattgaacttaatggcttgaactgaatgcttactaaataaacatgattggtcgttaaaaaaatgccatcagccatttcttgtaaataaatacacgaagctatattttttttatttgtatgaccaatgtttgttccagtactgatccagtttcaacatctgcagttcttcggtgaccaacctccgggcgcatctgcaccattggcatcccgaaatggcgtcctcagggtgtaccgatgaattatgctaacacagaagaagatataactctaatctggttgaccatacagaactacctttcttgttcaaggcactttttggggacaggggacgccttttcgcagttctcgtcgtcttacactagcgatggttgctaccatcgaattcatttggtgtatatactgttgttcgtcttataaaacatgagcagttttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0224700, RefSeq:Os03g0224700