Difference between revisions of "Os09g0106700"
Wbaochengll (talk | contribs) (→Function) |
Wbaochengll (talk | contribs) (→Annotated Information) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | * ''PutAKT1'' is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii) unlike its homologs in rice, even under saltstress condition. | + | * ''PutAKT1'' is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii) unlike its homologs in rice, even under saltstress condition.The notion that ''AKT1''-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of ''AKT1''-disrupted mutants. |
===Expression=== | ===Expression=== | ||
| − | The expression of ''PutAKT1'' was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing ''PutAKT1'' showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight. Expression of ''PutAKT1'' | + | *The AKT1 is preferentially expressed in peripheral root cell layers and root hairs. |
| + | *Expression of ''PutAKT1'' increased the K+ content under normal K+ -starvation,and NaCl-stress conditions. | ||
| + | *The expression of ''PutAKT1'' was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing ''PutAKT1'' showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight. | ||
| + | * Expression of ''PutAKT1'' also showed a decrease in Na+ accumulation both in the shoot and in the root. | ||
| + | ====Expression in experiment==== | ||
| + | Subjected to NaCl and K+-starvation stresses for 24 h, ''PutAKT1'' was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, ''PutAKT1'' expression was monitored over a 24-h period. | ||
| + | *In rice, the expression | ||
| + | level of ''PutAKT1'' is down-regulated by excessive external NaCl. Under K+-starvation stress, ''PutAKT1'' was dramatically induced at 24 h of stress. | ||
===Evolution=== | ===Evolution=== | ||
| − | ''PutAKT1'' belongs to the ''AKT1''-subfamily in the Shaker K+ channel family. ''PutAKT1'' was localized in the plasma membrane and it was preferentially expressed in the roots. | + | ''PutAKT1'' belongs to the ''AKT1''-subfamily in the Shaker K+ channel family. ''PutAKT1'' was localized in the plasma membrane and it was preferentially expressed in the roots.there are three ''AKT1''-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that ''PutAKT''1 belongs to a small gene family. |
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 03:11, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
- PutAKT1 is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii) unlike its homologs in rice, even under saltstress condition.The notion that AKT1-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of AKT1-disrupted mutants.
Expression
- The AKT1 is preferentially expressed in peripheral root cell layers and root hairs.
- Expression of PutAKT1 increased the K+ content under normal K+ -starvation,and NaCl-stress conditions.
- The expression of PutAKT1 was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing PutAKT1 showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight.
- Expression of PutAKT1 also showed a decrease in Na+ accumulation both in the shoot and in the root.
Expression in experiment
Subjected to NaCl and K+-starvation stresses for 24 h, PutAKT1 was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, PutAKT1 expression was monitored over a 24-h period.
- In rice, the expression
level of PutAKT1 is down-regulated by excessive external NaCl. Under K+-starvation stress, PutAKT1 was dramatically induced at 24 h of stress.
Evolution
PutAKT1 belongs to the AKT1-subfamily in the Shaker K+ channel family. PutAKT1 was localized in the plasma membrane and it was preferentially expressed in the roots.there are three AKT1-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that PutAKT1 belongs to a small gene family.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os09g0106700 |
|---|---|
| Description |
Similar to Myb proto-oncogene protein (C-myb) |
| Version |
NM_001069097.1 GI:115477933 GeneID:4346379 |
| Length |
1586 bp |
| Definition |
Oryza sativa Japonica Group Os09g0106700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:603500..605085 |
| Sequence Coding Region |
604001..604960 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:603500..605085 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:603500..605085 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaa</cdnaseq> |
| Protein Sequence |
<aaseq>MMASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLIS KSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRT DNAIKNHWNSTLKRKHHSSLLADDLRPLKRTTSDGHPTLSSAAAPGSPSGSDLSDSSH HSLPSQMPSSPPHLLLPQHVYRPVARAGGVVVPPPPPPPPPATSLSLSLSLPGLDHPH PDPSTPSEPAVQLQPPPPSQMPPPTPSCVRQEPPQMPFQLQPPPPPRPSAPFSAEFLA MMQEMIRIEVRNYMSGSAAVDPRSSPDNGVRAASRIMGMAKIE</aaseq> |
| Gene Sequence |
<dnaseqindica>126..1085#ctgacttaatttagctccgcctccattcacgcattcacactagcatagcatataagatagcacttgtagagaggagatactagtacacatagagaagaggagaggagattgatcggtgagggaggatgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaatcaaccagccgcagcagcatacggaatgatcgagtaatcaagctcagattgatgcactgcaagcaagaaagcagagcaagaagcagaggcgccggcgcggcaagtgaagagacgacgaccatcaacgtttggatcctccttttctattctgctatagtcttcttcttccccaataattccttgtctagttttaatttttttttctcttcaatttttactcctccaatccaagttgaagttgtcactagtagagttctccagagagagaggagatgaagcaacaacaaggagctgtgtctgcctgtctggaggaactaataccaaaccaaaataagcagagtgtgtgctgctgtgccacaatcagcaccaccaccgtggcaccacccactagcttagcttagctagctagttcaaagttctttttgtatatacttataagaggaaaaagaaaaaagagagctgatcagtgaaaattcagaatgcatcagtgaagagaattgc</dnaseqindica> |
| External Link(s) |
