Difference between revisions of "Os02g0535400"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
The gene locus Os02g0535400 is a gene called Os RAR1(NCBI Gene ID: 4329567) and this gene codes a protein called Cysteine and histidine-rich domain-containing protein RAR1( [http://www.ncbi.nlm.nih.gov/protein/Q6EPW7.2 NCBI ACCESSION:Q6EPW7])<ref name = "ref 1"/>. RAR1 is an important component in innate immunity in Rice. RAR1 is required for basal resistance against compatible races of rice blast and bacterial blight and this resistance is mediated by Os Rac1
+
The gene locus Os02g0535400 is a gene called Os RAR1([http://www.ncbi.nlm.nih.gov/gene/?term=AK111881 NCBI Gene ID: 4329567]) and this gene codes a protein called Cysteine and histidine-rich domain-containing protein RAR1( [http://www.ncbi.nlm.nih.gov/protein/Q6EPW7.2 NCBI ACCESSION:Q6EPW7])<ref name = "ref 1"/>. RAR1 is an important component in innate immunity in Rice. RAR1 is required for basal resistance against compatible races of rice blast and bacterial blight and this resistance is mediated by Os Rac1
  
 
===Expression===
 
===Expression===

Revision as of 09:59, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The gene locus Os02g0535400 is a gene called Os RAR1(NCBI Gene ID: 4329567) and this gene codes a protein called Cysteine and histidine-rich domain-containing protein RAR1( NCBI ACCESSION:Q6EPW7)[1]. RAR1 is an important component in innate immunity in Rice. RAR1 is required for basal resistance against compatible races of rice blast and bacterial blight and this resistance is mediated by Os Rac1

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0535400

Description

Conserved hypothetical protein

Version

NM_001053574.1 GI:115446518 GeneID:4329567

Length

2767 bp

Definition

Oryza sativa Japonica Group Os02g0535400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:20584982..20587748

Sequence Coding Region

20586274..20586295,20587512..20587747

Expression

GEO Profiles:Os02g0535400

Genome Context

<gbrowseImage1> name=NC_008395:20584982..20587748 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:20584982..20587748 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gtagagactagagaggccacaggcggcggcggcagcagcggaagtctctcgtctcgtccgtggagaaagggggaagacgaagatgtcgacggaggcggagaccaccagcgccgccgcccccgcccccgcccccgcccccgcatcggcgccggcgcggtgccagcggataggctgcgacgccacgttcaccgacgacaacaaccccgacggctcctgccaataccacccctccgtgacctatgtttcatgatggcatga</cdnaseq>

Protein Sequence

<aaseq>VETREATGGGGSSGSLSSRPWRKGEDEDVDGGGDHQRRRPRPRP RPRIGAGAVPADRLRRHVHRRQQPRRLLPIPPLRDLCFMMA</aaseq>

Gene Sequence

<dnaseqindica>1454..1475#2..237#agtagagactagagaggccacaggcggcggcggcagcagcggaagtctctcgtctcgtccgtggagaaagggggaagacgaagatgtcgacggaggcggagaccaccagcgccgccgcccccgcccccgcccccgcccccgcatcggcgccggcgcggtgccagcggataggctgcgacgccacgttcaccgacgacaacaaccccgacggctcctgccaataccacccctccgtgagtcctcctcctccccttcttccccttctaaatctcatggggtctaactaattgccccgcggattacgggagtggaggagtctgttcttctagggggaagttgggcagttcgaatctgtaatggcggggtcaagggcttcgcctgctcttgggaaacttctggggacgaattgggcagcggggaatatttgagttctatatacaataatgaaatttagtgtcatatagagatatgttggactacactcattactcatagtagattagtggattggattgcacgattatactcatagtagattagtagattagtggattggattacacgattcaatcagaagggttattgatgccattggcaaaaggtattgtagttgtcgcaaacacgtgatattaggtggttttttttttgccccttatttgggttaggatattggtaccttgaagctgcctcttgatgaggcatcatgggcaatgtgtctgatgtgtggcgagggatttttttcccctttggatatggctcacatgagtgctgactatttacaaaaagcaaaaggaaaagaggcaaagaactacctttcccttcagagagtaaacaaaattaatttggaataaagatatgacattctctttctctttctctttttcaatccctaccgtgtctaagggtcagatacccatgttgtaccaaaaaaggattaagtacacaaacagctgctgcaaaacttcttcacaacttcttctatttccaattgtgaatatctcttgataacaatggaagaaataatggttaattttttcaagcaattcttttcttttgtctccaaagattcaaatcacattgctaactttgtgatgccatgccaaattccattgtaatatttaaacaccaaattcacactcatgtttactgcatttggtctagaagaaatacacaacagctagtataagagaatacctaaatgtggtcccattcttttttggaaaatgacgaataaagcaacatatttaaacaagactcgtataatatgtttgctaactctctttatggtttcttgtctactgccaaatactatatttatttccaattttccactgtagtgttctgaccactgtctccttttttttttcttgcagggagtaagtgtttcttctttgcatgagagggtacttctagaaggatgcataggttaattttctaagattttttttttcagcctatgtttcatgatggcatgaaacagtggagttgctgtaagcaaaaaagccatgattttagcctatttttggctattcctgggtaaggatccctctctagtatttccttttcacagcatgcacccacaacataagtcaactatgtgctatcaacctgaacattaccatctgggctggcctgttgtgtattttagcaaaaccaagcatgaatgcatgaatcgtatgctgtactgctgtgtaggtgcaaaactggaaagcacacaactgagaaaccaatcacaaaagcagttcctactaaaccatcaaaggcagttccagtccagacttcgaagcagagtgtgggagctgacacttgctcaaggtgccgtcaaggtttcttttgctctgaccatggtgagtttctgtctataagcataatgcttggatacaactgattgatcccctatttgggtgtaacagctgattgtttcgttattattttaacgactgacatccctatgcatttttatgtgttgatagaataaatcgtaacttttaatttaacagattatgcactgctattttttcaggatcacaacccaaggcacaaataccaaccgctaccagtgatactaacatggtacctgttgagaagcctgcagttccaccaccaaagaaaaaaattgatctgaatgagcctagggtttgtaagaacaaaggatgtggtaaaacctacaaggagaaggataatcatgatgaagcatgcgattaccatccaggacctgcagtttttcgcgacaggattagaggggtatgtttttggttcaaacttattgttgttttgctctattccttgatttttgccatcactgactctgacatctttttaaaaatttttgcagtggaaatgttgtgatattcatgtcaaggaatttgatgaatttatggagatccctccgtgcacaaagggttggcacaatgctgatgccgcatgaattttcaccatgccccatcttggaataagaaccctattagcataaggttctcttgtatctcgtagtgcataaggtgcaatttttatggagaattttacttggagttggggagtgtggcaaagataccgagaataggctgttttaccgtgctctgtgtgactgctgcaaaagtgtgcgtggtgtttcattttttgtctgaaacggggacttgaaattgtgtgtggagacttcggtctcgttcgttggctcgttgccaattcttcatagttagaaaatcaaatgctccatctaaatgctatcctgcagacttttggtaacacccatctttctgtttatatg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0535400, RefSeq:Os02g0535400

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref_1