Difference between revisions of "Os03g0657000"
(→Expression) |
(→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ||
| + | TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II (RNA Pol II). Binding of TFIID to the TATA box in the promoter region of the gene initiates the recruitment of other factors required for RNA Pol II to begin transcription. Some of the other recruited transcription factors include TFIIA, TFIIB, and TFIIF. Each of these transcription factors is formed from the interaction of many protein subunits, indicating that transcription is a heavily regulated process. | ||
| + | |||
| + | TBP is also a necessary component of RNA polymerase I and RNA polymerase III, and is, it is thought, the only common subunit required by all three of the RNA polymerases. | ||
| + | |||
| + | When TBP binds to a TATA box within the DNA, it distorts the DNA by inserting amino acid side-chains between base pairs, partially unwinding the helix, and doubly kinking it. The distortion is accomplished through a great amount of surface contact between the protein and DNA. TBP binds with the negatively charged phosphates in the DNA backbone through positively charged lysine and arginine amino acid residues. The sharp bend in the DNA is produced through projection of four bulky phenylalanine residues into the minor groove. As the DNA bends, its contact with TBP increases, thus enhancing the DNA-protein interaction. | ||
| + | |||
| + | The strain imposed on the DNA through this interaction initiates melting, or separation, of the strands. Because this region of DNA is rich in adenine and thymine residues, which base-pair through only two hydrogen bonds, the DNA strands are more easily separated. Separation of the two strands exposes the bases and allows RNA polymerase II to begin transcription of the gene. | ||
| + | |||
| + | TBP's C-terminus composes of a helicoidal shape that (incompletely) complements the T-A-T-A region of DNA. It is interesting to note that this incompleteness allows DNA to be passively bent on binding. | ||
| + | |||
| + | The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box. TBP associates with a host of factors, including the general transcription factors TFIIA, -B, -D, -E, and -H, to form huge multi-subunit pre-initiation complexes on the core promoter. Through its association with different transcription factors, TBP can initiate transcription from different RNA polymerases. There are several related TBPs, including TBP-like (TBPL) proteins. | ||
===Expression=== | ===Expression=== | ||
Revision as of 16:25, 10 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II (RNA Pol II). Binding of TFIID to the TATA box in the promoter region of the gene initiates the recruitment of other factors required for RNA Pol II to begin transcription. Some of the other recruited transcription factors include TFIIA, TFIIB, and TFIIF. Each of these transcription factors is formed from the interaction of many protein subunits, indicating that transcription is a heavily regulated process.
TBP is also a necessary component of RNA polymerase I and RNA polymerase III, and is, it is thought, the only common subunit required by all three of the RNA polymerases.
When TBP binds to a TATA box within the DNA, it distorts the DNA by inserting amino acid side-chains between base pairs, partially unwinding the helix, and doubly kinking it. The distortion is accomplished through a great amount of surface contact between the protein and DNA. TBP binds with the negatively charged phosphates in the DNA backbone through positively charged lysine and arginine amino acid residues. The sharp bend in the DNA is produced through projection of four bulky phenylalanine residues into the minor groove. As the DNA bends, its contact with TBP increases, thus enhancing the DNA-protein interaction.
The strain imposed on the DNA through this interaction initiates melting, or separation, of the strands. Because this region of DNA is rich in adenine and thymine residues, which base-pair through only two hydrogen bonds, the DNA strands are more easily separated. Separation of the two strands exposes the bases and allows RNA polymerase II to begin transcription of the gene.
TBP's C-terminus composes of a helicoidal shape that (incompletely) complements the T-A-T-A region of DNA. It is interesting to note that this incompleteness allows DNA to be passively bent on binding.
The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box. TBP associates with a host of factors, including the general transcription factors TFIIA, -B, -D, -E, and -H, to form huge multi-subunit pre-initiation complexes on the core promoter. Through its association with different transcription factors, TBP can initiate transcription from different RNA polymerases. There are several related TBPs, including TBP-like (TBPL) proteins.
Expression
TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II (RNA Pol II). Binding of TFIID to the TATA box in the promoter region of the gene initiates the recruitment of other factors required for RNA Pol II to begin transcription. Some of the other recruited transcription factors include TFIIA, TFIIB, and TFIIF. Each of these transcription factors is formed from the interaction of many protein subunits, indicating that transcription is a heavily regulated process.
TBP is also a necessary component of RNA polymerase I and RNA polymerase III, and is, it is thought, the only common subunit required by all three of the RNA polymerases.
When TBP binds to a TATA box within the DNA, it distorts the DNA by inserting amino acid side-chains between base pairs, partially unwinding the helix, and doubly kinking it. The distortion is accomplished through a great amount of surface contact between the protein and DNA. TBP binds with the negatively charged phosphates in the DNA backbone through positively charged lysine and arginine amino acid residues. The sharp bend in the DNA is produced through projection of four bulky phenylalanine residues into the minor groove. As the DNA bends, its contact with TBP increases, thus enhancing the DNA-protein interaction.
The strain imposed on the DNA through this interaction initiates melting, or separation, of the strands. Because this region of DNA is rich in adenine and thymine residues, which base-pair through only two hydrogen bonds, the DNA strands are more easily separated. Separation of the two strands exposes the bases and allows RNA polymerase II to begin transcription of the gene.
TBP's C-terminus composes of a helicoidal shape that (incompletely) complements the T-A-T-A region of DNA. It is interesting to note that this incompleteness allows DNA to be passively bent on binding.
The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box. TBP associates with a host of factors, including the general transcription factors TFIIA, -B, -D, -E, and -H, to form huge multi-subunit pre-initiation complexes on the core promoter. Through its association with different transcription factors, TBP can initiate transcription from different RNA polymerases. There are several related TBPs, including TBP-like (TBPL) proteins.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0657000 |
|---|---|
| Description |
TATA-binding protein TBP2 |
| Version |
NM_001057347.1 GI:115454422 GeneID:4333619 |
| Length |
4417 bp |
| Definition |
Oryza sativa Japonica Group Os03g0657000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:26394921..26399337 |
| Sequence Coding Region |
26395103..26395188,26396166..26396253,26396861..26396932,26397856..26397906,26397981..26398025 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:26394921..26399337 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:26394921..26399337 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggcggaggcggcagcggcgctggaggggagcgagcccgtggacctggccaagcacccctccggcatcatccccacgctccaaaacatcgtatcgacggtcaatttggattgcaaattagacctcaaagctatagctttgcaagctcgcaatgcagaatataatccaaagcgttttgctgcggttatcatgagaataagagaaccaaaaactacagctctgatatttgcatcgggtaaaatggtctgtactggggcaaagagtgaacaacaatccaagcttgcagcaagaaagtacgctcgtattatccagaagcttggctttcctgctaaattcaaggatttcaagattcagaacattgttggctcttgtgatgttaaatttccaatcaggctggagggacttgcatattctcatggtgctttctcaagttatgagccagaactctttcctggtctgatatatcggatgaagcaaccaaagattgttcttctgatttttgtttcaggcaagattgttttgaccggagcaaaggtgagggatgagacgtataccgcctttgagaacatataccctgtgctaacggagttcagaaaagtccagcagtga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAEAAAALEGSEPVDLAKHPSGIIPTLQNIVSTVNLDCKLDLK AIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYAR IIQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQ PKIVLLIFVSGKIVLTGAKVRDETYTAFENIYPVLTEFRKVQQ</aaseq> |
| Gene Sequence |
<dnaseqindica>183..268#1246..1333#1941..2012#2936..2986#3061..3105#3204..3296#3382..3483#3558..3631#gcgagagcgcatagataaccctagcctcccccttcctcttcctctcctccttctctcgatctctataaaagacctcggatttcgaattcctccgccccgcgcgcgcgcgccacctcccccacgcccgtcgcgcccttttttttgggggtgggattcgcctggtcaagtgccatcgtcggatcatggcggcggaggcggcagcggcgctggaggggagcgagcccgtggacctggccaagcacccctccggcatcatccccacgctccagtaagtcccggatctgcgcggatctgcgggattcctgtgggtggggtgagagattcggtccgcggggggatttggggtccttttagcttgttgtgtgttgagggggggggggggggggttgaggtggaatggaatggttgattcgcggcgcgaggttttgttctttggggggattgttgcaaatcgtgggaaaggtggtagccttgggttggattttttttttttggggggggggtttaatatgtagcgtttgaaagggggggcgatctgagatctgcgaatccgggtggagaagaaagaggatgtgctgtgctgtgctgtgatagatccattgtccggtctttcaactcttttagctaccatatagtttatatgatatacaggttgaatccgctggtcagcttttttttttttggggggggggggaatcagataataatcaatcatgcatctgattttagatttaatgctttctgctcacggttttcaatattagaggggttatatctgtagagagtttaggccttagggttcttatggcatacagttcacatgagtcactgtttgtttttagacagctcgaagttctaaacaacacatttaggctttattaatccatgtatcggccaatacgggcaagcacggccgtttattagcatgatgtacttgctggtgtgctctggaacgtgtggctgcctgcgttgctaccaagcatgtacatttgcatgctggtgtgcgctgctaaaaggttggacatgcttatgttgctgcctgtcatagtatacttgttgccatgcattctcagaagtgcgcatgtctgttttgctgccttgctgggttgtttatgttgcagtgttgggatcatagctgctgtctgcatgtgtcccactctgtttaagcttatgattcttcctttggttacactcatcagtgaaattgtggtccttattatgcattctcttttattttgatggcagaaacatcgtatcgacggtcaatttggattgcaaattagacctcaaagctatagctttgcaagctcgcaatgcagaatataatccaaaggtattatgatggcttcggtgtgttctagtgtctctgttttggctcaaaaggatatcttcattgcatgttaaaatgataccaatgttattcttagtagcatgtaatatgtagacaaggtccatatattcctatggtctgttcctagagtgatatttcctttgtgtataacataagtgttagtgcaattttagatgtcagtatggataaatccatagttgacagtcgagttttgtaaggcaagtctcagttaagatagtgaagacagcttgtcccacagataaacaaattgctctacaaataagattataaaaattactctttttagtgctttgggctttttatctgtgctgcatgtaccagacgcagcacgaggtattgggagattttgtaactatatgtaatatcgtaagctaaatctaggtgtaccatgtttgctttaataataaatacattttggaaggaacagacatagcgcacactggggttataaacatctctatctagtatcttagattgatttacactatgtcagtggcgcactatataatttcatactcatttgctgtaatttatgttttagtttgctaattcctcctttcataaacagcgttttgctgcggttatcatgagaataagagaaccaaaaactacagctctgatatttgcatcgggtaaaatggtatggttcaacttcttgtaccgtgactgcaaatgttctgttttgttcatctgcttattgacttgtgaattgttttgttatctgtccaatggccagctgttgatcttgtagctattataatgcatattgattcatgaactgtttttgctgctgtgtaactgcttttgctattagcatactatctttttagtttttatttacttgttaacagctatcacatccctacctttatccgtgccgcattgcagcctgtatttcaatgttgaatctgtgaatttacttttgctctgatttttctgacatgtttgctgttgcattggtgtgtcaatagctatcacatccatatctgatccaagcagcctgtagttcaatgttgaatctgtaaatttaattttgctctgagtttatgaaatgtttgctgttgcattgctgtgtcatatagtaataactgcatgagtattgttctttctgtgaatgtatagtttgtccttgttaacttttttatggctttaaagcataataggaattgtttattcacaataaattgaacctaacatatttatttgttgaaggataatcagcaatagcacatcacatgcttcctgtctggtcaatatcttcatttttcttgaaaatcacttgaattttcttttggttcaatatctccatccaaataactttacctgttgaagccttaggcttactagtatgtcgtatggggcctgtctgttaggcagtgaacttaaagaaagggttgccatgggtttgacgcaccaatttgttgcatcttttcttctcttttttcctttgtataaaaaaaacaaatatggctgttaaccaaaatttctcagtgtccaccgtgatgtctggcatctatggttaaattagaggtctgtttataaatcttttgtgtcctataccaggtctgtactggggcaaagagtgaacaacaatccaagcttgcagcaagaaaggtatgagcggtagtttttattttattttgctatatctgtctctctgaagtcttaacactagtttttatcaccagtacgctcgtattatccagaagcttggctttcctgctaaattcaaggtaactatttcaagcttgcttgattttcatctgtgcatgtgcctaccaaatacattctgtaattgtacctaactgtttaactcattgcactataccaggatttcaagattcagaacattgttggctcttgtgatgttaaatttccaatcaggctggagggacttgcatattctcatggtgctttctcaagtgtaagttgagtccttgcatgcctttttaggacgcctttcacatttgttatgttgttcttatgtcctgtgccttttgtgttaacagtatgagccagaactctttcctggtctgatatatcggatgaagcaaccaaagattgttcttctgatttttgtttcaggcaagattgttttgaccggagcaaaggttagcagcctttccttttgtatattcttgattgcctattcctttttgtatgtctgaatatactgtctttataggtgagggatgagacgtataccgcctttgagaacatataccctgtgctaacggagttcagaaaagtccagcagtggtatgtctttattttgttatttaagtatgcagtgtgctgtacaaatatcggaacaatacatgaagtaggaatgatagtggataattgcaacttatctgtcttttgttatattatatatgtgagtggaccatgggcatatactaaattgcaatatgttgcatcttttaatattgttactggtctatggttgtaaactatcctttgtagtgtaagcacctaataaatctaaactttccaattagaatccagatggtttagcagaaactgaaggcacaatttatctcaagaaaaagattttaatttaccactaccttgatcttagacaggatatactgatggttttagatgccatgaagcaataccgcgtgatatactgatggtttcttgctccttccaatttgcagaaaacttatggaatacacaagtacaagcttccttgagattttgctgcctagtgactgctaatcttaactgtacatatggtctggaggagcgtatagcatcttgtaatttatgtgagcccctcgatgcacgagtgttgtagacttgttgtagtaggcttgtagcttgggtgactgagagacttgagtatcgcgttcagtcgaacgaggtggagacgtggagttatcgtactttagcccgtgctgatttttttcccttcacaaatagatctgtagcgaaacattttattacagaaatgggcggctaacttttaacaaacagaacatatgtactgtggatgcgttgcgttttacagtagaatgtcatggactgtttggatggtgg</dnaseqindica> |
| External Link(s) |