Difference between revisions of "Os02g0114000"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Os02g0114000 is one of SNF2 family genes.The catalytic subunits of chromatin remodeling complexes belong to the SNF2 family of DNA-dependent ATPases.Their catalytic core consists of two characteristic domains, the SNF2_N domain located at the N-terminus and the Helic C domain located at the C-terminus. Now there are five classes of ATP-dependent chromatin remodelers operating in eukaryotes: SWI/SNF, ISWI, CHD1, SWR1 and RAD54.The first SWI/SNF ATPase was found in ''Saccharomyces cerevisiaemutants'' which showed sucrose-nonfermenting and mating type switching defective phenotypes, thus the SNF2 family has got its name. The studies in single-cell organisms, invertebrates and mammals have indicated that SWI/SNF ATPases are essential for transcriptional reprogramming, morphogenesis, early embryo develop-ment, patterning and differentiation throughout development. In plants, detailed research on two viable null mutants of SWI/SNF ATPases,SPLAYED (SYD) and BRAHMA (BRM), in ''Arabidopsis thaliana'', improved our information on critical roles of plant SWI/SNF ATPases. Both SYD and BRM regulate stem cell maintenance, patterning (alteration of leaf polarity, flower morphogenesis and ovule development), develop-mental transitions (precocious onset of reproductive development) and growth (small stature, slow growth and reduced apical dominance), while BRM also controls root growth and male fertility. Recently SYD has been found to be also required for selective pathogen resistance and regulation of the specific pathways within biotic stress signaling networks. ATCHR12, another SWI/SNF ATPase in A. thaliana, has been demonstrated to play a vital role in mediating the temporary growth arrest of Arabidopsisupon perception of environmental stresses. All these three SWI/SNF ATPases have an HSA domain at the N-terminus, lately shown to mediate critical interactions required for SWI/SNF-dependent trans-criptional activation. BRM also have a C-terminal BROMO domain found to target remodeling complexes to hyperacetylated chromatin in yeast.
  
 
===Expression===
 
===Expression===

Revision as of 06:48, 11 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Os02g0114000 is one of SNF2 family genes.The catalytic subunits of chromatin remodeling complexes belong to the SNF2 family of DNA-dependent ATPases.Their catalytic core consists of two characteristic domains, the SNF2_N domain located at the N-terminus and the Helic C domain located at the C-terminus. Now there are five classes of ATP-dependent chromatin remodelers operating in eukaryotes: SWI/SNF, ISWI, CHD1, SWR1 and RAD54.The first SWI/SNF ATPase was found in Saccharomyces cerevisiaemutants which showed sucrose-nonfermenting and mating type switching defective phenotypes, thus the SNF2 family has got its name. The studies in single-cell organisms, invertebrates and mammals have indicated that SWI/SNF ATPases are essential for transcriptional reprogramming, morphogenesis, early embryo develop-ment, patterning and differentiation throughout development. In plants, detailed research on two viable null mutants of SWI/SNF ATPases,SPLAYED (SYD) and BRAHMA (BRM), in Arabidopsis thaliana, improved our information on critical roles of plant SWI/SNF ATPases. Both SYD and BRM regulate stem cell maintenance, patterning (alteration of leaf polarity, flower morphogenesis and ovule development), develop-mental transitions (precocious onset of reproductive development) and growth (small stature, slow growth and reduced apical dominance), while BRM also controls root growth and male fertility. Recently SYD has been found to be also required for selective pathogen resistance and regulation of the specific pathways within biotic stress signaling networks. ATCHR12, another SWI/SNF ATPase in A. thaliana, has been demonstrated to play a vital role in mediating the temporary growth arrest of Arabidopsisupon perception of environmental stresses. All these three SWI/SNF ATPases have an HSA domain at the N-terminus, lately shown to mediate critical interactions required for SWI/SNF-dependent trans-criptional activation. BRM also have a C-terminal BROMO domain found to target remodeling complexes to hyperacetylated chromatin in yeast.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0114000

Description

Bromodomain containing protein

Version

NM_001052200.2 GI:297598474 GeneID:4328058

Length

2692 bp

Definition

Oryza sativa Japonica Group Os02g0114000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:748726..751417

Sequence Coding Region

749122..749799,750123..750371,751380..751415

Expression

GEO Profiles:Os02g0114000

Genome Context

<gbrowseImage1> name=NC_008395:748726..751417 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:748726..751417 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>agtggaacaaagatgtctgacagtatgcaaagaaagtgcaagaacgtgataaacaagctttggaggaggattgacaaagagggtcatcaaatcataccaaatatatcttcttggtggcgtaggaacgagaattcctcattcaaaggtttggctagcagcacccttgatctacagaaaattgaacaacgagttgatggatttgagtatggcggtgtgaatgaattcatagctgacatgcagcagatgctgaaaagtgtggttcaacatttcagctataggcatgaggtccgagtagaagctgagaccctccacaacttatttttcaatataatgaagattgcctttccggactcagacttcagagaagctaagggtgctatgtcattttcgaatcctggaggaggtgcaagtggctctgctgcgcaatcaacaaagcaatctgcttcaggccagaaacgtcgttcaagcaccagtgaagcggagcagcatggttcaagcactagcagacacaatcagcatgcaccagttggtgaggtttcaggccgggcccacacttcaaaatctgagaaggactcccggcattctggaccaggtagcagggaacagttcacggatagcgcagggctgttcaggcaccctacagatatgttcatagttaagaagaagagagatcgaaggccgagcctggggtctccatccagttcaggccgaactggaccgctctccccgaccaacgccgggcggatgggaccggcgccatcacctagaggtgccaggacgcccttccaaagagatccacacccttctcagcagtctatgcattcagctggatggggtgctcattctgtgcagcaatctgatcgtggggggagttcatcacccggcattggagacatccagtgggctaaacctaccaagagatcgaggactgatagtggcaaaagacggccaagccatatgtga</cdnaseq>

Protein Sequence

<aaseq>SGTKMSDSMQRKCKNVINKLWRRIDKEGHQIIPNISSWWRRNEN SSFKGLASSTLDLQKIEQRVDGFEYGGVNEFIADMQQMLKSVVQHFSYRHEVRVEAET LHNLFFNIMKIAFPDSDFREAKGAMSFSNPGGGASGSAAQSTKQSASGQKRRSSTSEA EQHGSSTSRHNQHAPVGEVSGRAHTSKSEKDSRHSGPGSREQFTDSAGLFRHPTDMFI VKKKRDRRPSLGSPSSSGRTGPLSPTNAGRMGPAPSPRGARTPFQRDPHPSQQSMHSA GWGAHSVQQSDRGGSSSPGIGDIQWAKPTKRSRTDSGKRRPSHM</aaseq>

Gene Sequence

<dnaseqindica>1619..2296#1047..1295#3..38#caagtggaacaaagatgtctgacagtatgcaaagaaaggtagcatacaaaacctagttctttgtatgtttcagctggtttactctgttagagctactcattgcctcgtcttttaaaacttaaaaggatattggatattgaacttcggcaaggaatactttgtagaatttagtatactctgtcgtgtaagcatcatcttaagaaagatggttccgccttcaaaatagcagagccatgatccttccaaatgtaggaatagaccattttagtatgcaatagacaaacgctagctaaaaactgccaccacacatggcttggtccctgctcgttaaacgttgccgagcatggaaaactagaacagatgagcaatatatcaaggaagcaatgttctttttaccttggaaacataaatggatctgcagttttctatagaagtataatacttgcctaaaatcttgtaaaatatttattcggactgttaactcaacttgataacataaatatggaagttaaatgttgcctacataccgggatagttgaggtctaccaaatatactgcattgctaggtaaatctcgactgctatctgcttgcattagcaaaagagccaagtatgacgccgcttatttcatgtggtgttttcacattgttctacaatcataacaacgtaagtcccgtgcagtggttgtggggtgcacgtgaagtggtgtggactatttcatgactattgcctgtttttgcttatactgattactagtgtagtttttggatatcatttattactacagcttatccgttgtgttgattttgttgtagattccttttgccatttggtttggctcatattgtttgccttcttttttttttgactgcttttgcttacactgattactagtgtagtttttggatatcatttattactacagcttatcttaatgttgaggttgtctcaattttgttgtaattcctttcgcaaatggtttggctcgtattgtttgcctttttaacagctctttatagctaagcgtttctcattcaatacctgcagtgcaagaacgtgataaacaagctttggaggaggattgacaaagagggtcatcaaatcataccaaatatatcttcttggtggcgtaggaacgagaattcctcattcaaaggtttggctagcagcacccttgatctacagaaaattgaacaacgagttgatggatttgagtatggcggtgtgaatgaattcatagctgacatgcagcagatgctgaaaagtgtggttcaacatttcagctataggcatgaggtaatttcatagtactagaaaagcttccttttttgtccttaatttgtataaattgaagtatcatgggggtcattccaatgctgacaccatgggtccatggtcgccatcaagtttgttgacattctctctctacttggtactgattactatttaaaattcagaagaactgcgtagctttctgtattcctgaagaaaaccatgttgacttaatagaataagataccacgacatacttgcacagactctaattctgtgaattcatacttctctaacttctgatagtctgactggtgtactcgtgaatttgctcctacaaaatgcaggtccgagtagaagctgagaccctccacaacttatttttcaatataatgaagattgcctttccggactcagacttcagagaagctaagggtgctatgtcattttcgaatcctggaggaggtgcaagtggctctgctgcgcaatcaacaaagcaatctgcttcaggccagaaacgtcgttcaagcaccagtgaagcggagcagcatggttcaagcactagcagacacaatcagcatgcaccagttggtgaggtttcaggccgggcccacacttcaaaatctgagaaggactcccggcattctggaccaggtagcagggaacagttcacggatagcgcagggctgttcaggcaccctacagatatgttcatagttaagaagaagagagatcgaaggccgagcctggggtctccatccagttcaggccgaactggaccgctctccccgaccaacgccgggcggatgggaccggcgccatcacctagaggtgccaggacgcccttccaaagagatccacacccttctcagcagtctatgcattcagctggatggggtgctcattctgtgcagcaatctgatcgtggggggagttcatcacccggcattggagacatccagtgggctaaacctaccaagagatcgaggactgatagtggcaaaagacggccaagccatatgtgaaaaagaaaagagggattgttattcttggcattgcggtgtacattccttagcacccttgaatcttgattgacctctctacccgctgctgattctggagcccattggcctggttttgacacccatttcttcgtcgccattcctgccatccttcaaagaagttatcacgaccgtctgggactgacttgtgttgtcatggacattgtgggaaatgtgggtaggagtaatcgttcttgtatgttggtattttctgtaaagggcaaacacatttaatcttgttctctgttgactgttaagtagcgctccatccaactggagatgtgatggcgatctcatgtcatgatgatgtagtttagtagccatggaatgaaatgaaatgaagctgagccggttataata</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0114000, RefSeq:Os02g0114000