Difference between revisions of "Os01g0248900"
(→protein 3D structure) |
(→Expression) |
||
| Line 7: | Line 7: | ||
===Expression=== | ===Expression=== | ||
Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. | Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. | ||
| + | =RNA coding sequence= | ||
| + | /translation="MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG | ||
| + | ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN | ||
| + | FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF | ||
| + | AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF | ||
| + | RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY" | ||
| + | ORIGIN | ||
| + | 1 gacgcgacaa tggcggccgc cagaatgctc gtgctcctgg cctctctctg cgctctcctg/ | ||
| + | 61 ctcacggcgt ccgcggccaa atggactcct gccttcgcga cgttctacgg cggcagcgac/ | ||
| + | 121 gcctccggca ccatgggcgg cgcatgcggg tacggcgacc tgtacggcgc cgggtacggg/ | ||
| + | 181 acgcggacgg cggcgctgag cacggcgctg ttcaacggcg gcgcgtcgtg cggcgcctgc/ | ||
| + | 241 ttcaccatcg cctgcgacac ccgcaagacg cagtggtgca agccggggac gtccatcacc/ | ||
| + | 301 gtgacggcga ccaacttctg ccctccaaac tacgccctgt ccggcgacgc cggcgggtgg/ | ||
| + | 361 tgcaacccgc cgcgccgcca cttcgacatg tcgcagccgg cgtgggagac gatcgcggtg/ | ||
| + | 421 taccgcgccg ggatcgtgcc cgtgaactac cgccgcgtgc cgtgccagcg gagcggcggc/ | ||
| + | 481 atccggttcg ccgtgaacgg gcacagctac ttcgagctgg tgctggtgac gaacgtcggc/ | ||
| + | 541 ggcagcggcg cggtggcgca gatgtggatc aaggggtccg ggacggggtg gatggcgatg/ | ||
| + | 601 agccgcaact ggggcgcgaa ctggcagagc aacgcgcgcc tcgacgggca ggcgctgtcg/ | ||
| + | 661 ttccgggtgc aggccgacga cggccgcgtc gtcacggcgg ccgacgtcgc gccggcgggg/ | ||
| + | 721 tggtcgttcg gcgccaccta cacctcctcg gctcagttct actgatgagc attaattgca/ | ||
| + | 781 agcctatctc atttaattaa tctggaccgt tcgatgtagt atattgtatg ctttgatcga/ | ||
| + | 841 cgtggcatag gatggaagag gccgcccacg aagaaaattt gggacttgtg tat | ||
=protein 3D structure= | =protein 3D structure= | ||
Revision as of 13:01, 11 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. =RNA coding sequence= /translation="MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG
ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN
FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF
AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF
RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY"
ORIGIN
1 gacgcgacaa tggcggccgc cagaatgctc gtgctcctgg cctctctctg cgctctcctg/
61 ctcacggcgt ccgcggccaa atggactcct gccttcgcga cgttctacgg cggcagcgac/
121 gcctccggca ccatgggcgg cgcatgcggg tacggcgacc tgtacggcgc cgggtacggg/
181 acgcggacgg cggcgctgag cacggcgctg ttcaacggcg gcgcgtcgtg cggcgcctgc/
241 ttcaccatcg cctgcgacac ccgcaagacg cagtggtgca agccggggac gtccatcacc/
301 gtgacggcga ccaacttctg ccctccaaac tacgccctgt ccggcgacgc cggcgggtgg/
361 tgcaacccgc cgcgccgcca cttcgacatg tcgcagccgg cgtgggagac gatcgcggtg/
421 taccgcgccg ggatcgtgcc cgtgaactac cgccgcgtgc cgtgccagcg gagcggcggc/
481 atccggttcg ccgtgaacgg gcacagctac ttcgagctgg tgctggtgac gaacgtcggc/
541 ggcagcggcg cggtggcgca gatgtggatc aaggggtccg ggacggggtg gatggcgatg/
601 agccgcaact ggggcgcgaa ctggcagagc aacgcgcgcc tcgacgggca ggcgctgtcg/
661 ttccgggtgc aggccgacga cggccgcgtc gtcacggcgg ccgacgtcgc gccggcgggg/
721 tggtcgttcg gcgccaccta cacctcctcg gctcagttct actgatgagc attaattgca/
781 agcctatctc atttaattaa tctggaccgt tcgatgtagt atattgtatg ctttgatcga/
841 cgtggcatag gatggaagag gccgcccacg aagaaaattt gggacttgtg tat
protein 3D structure
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan.
2. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb.
3. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1.
4. The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11.
Structured Information
| Gene Name |
Os01g0248900 |
|---|---|
| Description |
Similar to Expansin Os-EXPA3 |
| Version |
NM_001049122.1 GI:115435657 GeneID:4327217 |
| Length |
1014 bp |
| Definition |
Oryza sativa Japonica Group Os01g0248900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:8195063..8196076 |
| Sequence Coding Region |
8195191..8195819,8195941..8196067 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:8195063..8196076 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:8195063..8196076 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY</aaseq> |
| Gene Sequence |
<dnaseqindica>258..886#10..136#gacgcgacaatggcggccgccagaatgctcgtgctcctggcctctctctgcgctctcctgctcacggcgtccgcggccaaatggactcctgccttcgcgacgttctacggcggcagcgacgcctccggcaccatgggttagtagcaaattaagctcagctaatcaccatgcatgtgttaattaatcttttgcaaagtttaattggcatttacaataatggagtttggtctctctctcgtctcgtgtgtgatatccaggcggcgcatgcgggtacggcgacctgtacggcgccgggtacgggacgcggacggcggcgctgagcacggcgctgttcaacggcggcgcgtcgtgcggcgcctgcttcaccatcgcctgcgacacccgcaagacgcagtggtgcaagccggggacgtccatcaccgtgacggcgaccaacttctgccctccaaactacgccctgtccggcgacgccggcgggtggtgcaacccgccgcgccgccacttcgacatgtcgcagccggcgtgggagacgatcgcggtgtaccgcgccgggatcgtgcccgtgaactaccgccgcgtgccgtgccagcggagcggcggcatccggttcgccgtgaacgggcacagctacttcgagctggtgctggtgacgaacgtcggcggcagcggcgcggtggcgcagatgtggatcaaggggtccgggacggggtggatggcgatgagccgcaactggggcgcgaactggcagagcaacgcgcgcctcgacgggcaggcgctgtcgttccgggtgcaggccgacgacggccgcgtcgtcacggcggccgacgtcgcgccggcggggtggtcgttcggcgccacctacacctcctcggctcagttctactgatgagcattaattgcaagcctatctcatttaattaatctggaccgttcgatgtagtatattgtatgctttgatcgacgtggcataggatggaagaggccgcccacgaagaaaatttgggacttgtgtat</dnaseqindica> |
| External Link(s) |
