Difference between revisions of "Os10g0471100"

From RiceWiki
Jump to: navigation, search
(Expression)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Wax-deficient anther1 (Wda1), a rice homolog of Arabidopsis CER1, is strongly expressed in the epidermal cells of rice anthers. Wda1 mutant shows defects in the biosynthesis of very-long-chain fatty acids in both layers of anthers. The wda1 mutant exhibits developmental and
+
Wax-deficient anther1 (Wda1), a rice homolog of Arabidopsis CER1, is strongly expressed in the epidermal cells of rice anthers. The wda1 mutant exhibits developmental and biochemical phenotypes that reveal the functioning of Wda1 in the epidermal layer and tapetum of the anther wall, the orbicule in the peritapetal region and pollen development, and the biosynthesis of VLCFA derivatives required for cuticle formation and wax deposition. Wda1 mutant shows defects in the biosynthesis of very-long-chain fatty acids in both layers of anthers. Scanning electron microscopy analysis shows that epicuticular wax crystals were absent in the outer layer of the anther and that microspore development was severely retarded and finally disrupted as a result of defective pollen exine formation in the mature anthers. Biochemical analysis of the wda1 mutant anthers showed that the levels of very-long-chain alkanes, alkens, fatty acids, and primary alchols are severely reduced.
biochemical phenotypes that reveal the functioning of Wda1 in the epidermal layer and tapetum of the anther wall, the orbicule in the
 
peritapetal region and pollen development, and the biosynthesis of VLCFA derivatives required for cuticle formation and wax deposition. Scanning electron microscopy analysis shows that epicuticular wax crystals were absent in the outer layer of the anther and that microspore development was severely retarded and finally disrupted as a result of defective pollen exine formation in the mature anthers. Biochemical analysis of the wda1 mutant anthers showed that the levels of very-long-chain alkanes, alkens, fatty acids, and primary alchols are severely reduced.
 
  
 
===Expression===
 
===Expression===

Revision as of 04:30, 14 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Wax-deficient anther1 (Wda1), a rice homolog of Arabidopsis CER1, is strongly expressed in the epidermal cells of rice anthers. The wda1 mutant exhibits developmental and biochemical phenotypes that reveal the functioning of Wda1 in the epidermal layer and tapetum of the anther wall, the orbicule in the peritapetal region and pollen development, and the biosynthesis of VLCFA derivatives required for cuticle formation and wax deposition. Wda1 mutant shows defects in the biosynthesis of very-long-chain fatty acids in both layers of anthers. Scanning electron microscopy analysis shows that epicuticular wax crystals were absent in the outer layer of the anther and that microspore development was severely retarded and finally disrupted as a result of defective pollen exine formation in the mature anthers. Biochemical analysis of the wda1 mutant anthers showed that the levels of very-long-chain alkanes, alkens, fatty acids, and primary alchols are severely reduced.

Expression

Wda1 is a male-sterile mutant of rice, wax-deficient anther1 (wda1), that was generated through T-DNA insertional mutation, and is preferentially expressed in epidermis of various floral organs, including Anthers. This mutant shows morphological changes in its pollen and anther walls as well as alterations in its wax composition. Wda1 encodes a protein with high similarity to proteins involved in wax production.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0471100

Description

Sterol desaturase family protein

Version

NM_001071361.1 GI:115482465 GeneID:4348869

Length

5861 bp

Definition

Oryza sativa Japonica Group Os10g0471100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:17906207..17912067

Sequence Coding Region

17906494..17906655,17906746..17906922,17907019..17907117,17907202..17907402,17907731..17907838
,17907926..17908307,17908870..17909089,17910772..17911004,17911137..17911360
,17911825..17911884

Expression

GEO Profiles:Os10g0471100

Genome Context

<gbrowseImage1> name=NC_008403:17906207..17912067 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:17906207..17912067 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccacaaacccaggactcttcacggagtggccatggaagaagcttggcagcttcaagtacgtgttgctggcgccgtgggtagcgcacgggtggtatgaggtggcgaccaaggggtggcgggaggtggatctcgggtacatcgccatcctcccgtcgttgctgctgcggatgctgcacaaccaagcctggatcaccatctcccgcctccaaaacgcccgtggccgccgccagattgttcgccgcggcatcgagttcgaccaggttgaccgcgagaggaactgggacgaccagatcatcctgagcggtatcctactatacctcggcgcactgtacgtaccgggcgggcaacacttaccgctgtggaggacggatggcgcggggctgatcgccttgctgcatgcggggccagtggagttcctctactactggttccatcgtgcgttgcaccaccactttctctacacccactaccactcgcaccaccactcttcaatcgtcactgagcccatcacatccgtcatccatccgtttgctgagctcgttgcctacgaattgctcttctcgatcccactgatcgcctgtgccttgactggaactgcttccataattgcattcgagatgtatttgatttacattgatttcatgaacaacatggggcactgcaacttcgagttggtacccagctggctcttcacatggttccctcctctcaagtatctcatgtacacgccatcgtttcattctctgcaccacactcagtttcggacaaactactcccttttcatgccgttctacgattatatctacaacaccatggacaagtcatcagacactctgtatgagaactcactgaaaaacaatgaggaagaagaagcagtggatgtggttcaccttacacacctgaccaccctgcattccatctaccacatgaggcccggtttcgccgaatttgcgtccaggccctacgtttccaggtggtacatgaggatgatgtggcctctgtcatggctctccatggtgctgacatggacgtacggttcttcattcactgttgagaggaatgtcatgaagaagatcaggatgcagtcatgggccataccaagatacagtttccattatggattggattgggagaaggaagctatcaatgatcttatcgaaaaggcggtatgtgaagctgacaagaatggggctaaagttgtaagccttggactcctgaatcaggcacataccctgaataaaagtggagaacaatatctgctgaaatacccaaagttgggagcaagaattgtcgatggaaccagcttagctgctgcagtggttgtcaacagtatcccccaaggcacagaccaagtaattcttgcaggaaatgtttccaaggtggcgcgtgctgtagcgcaagcattatgcaagaaaaatatcaaagtcacgatgacaaacaagcaagattatcatttactcaagccagaaataccagaaactgtagctgacaatctttcgttttcgaaaacaggcaccgcaaaggtttggttaattggtgatggtctagattctgctgaacaattcagagcacagaaaggaactctgtttatcccatactcacaatttcctccaaagatggtacgcaaggacagctgcagctactcgacaactcctgcaatggctgtaccaaaaacgctgcagaatgtgcattcatgcgagaattggctgccaaggagggttatgagcgcatggcgaatcgcgggaattcttcatgcgttggagggatggaatgagcatgaatgtggtgacaaggtgcttgatatggacaaagtttggtctgctgcaattatgcatgggttctgcccagttgctcaaggttga</cdnaseq>

Protein Sequence

<aaseq>MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVD LGYIAILPSLLLRMLHNQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILS GILLYLGALYVPGGQHLPLWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHS HHHSSIVTEPITSVIHPFAELVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNN MGHCNFELVPSWLFTWFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKS SDTLYENSLKNNEEEEAVDVVHLTHLTTLHSIYHMRPGFAEFASRPYVSRWYMRMMWP LSWLSMVLTWTYGSSFTVERNVMKKIRMQSWAIPRYSFHYGLDWEKEAINDLIEKAVC EADKNGAKVVSLGLLNQAHTLNKSGEQYLLKYPKLGARIVDGTSLAAAVVVNSIPQGT DQVILAGNVSKVARAVAQALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSFSKTGTA KVWLIGDGLDSAEQFRAQKGTLFIPYSQFPPKMVRKDSCSYSTTPAMAVPKTLQNVHS CENWLPRRVMSAWRIAGILHALEGWNEHECGDKVLDMDKVWSAAIMHGFCPVAQG</aaseq>

Gene Sequence

<dnaseqindica>5413..5574#5146..5322#4951..5049#4666..4866#4230..4337#3761..4142#2979..3198#1064..1296#708..931#184..243#atatgagactctgacacgtacgcacagctagatcgaagccctggtcgagtttataaattgagatatatccgtcctccattctcaggccagttcttgcaagactcttgccgtgttgagactgcagaaacgagagctagctagccagaggctgcaagaagattctgcacccatagatcgtctaccatggccacaaacccaggactcttcacggagtggccatggaagaagcttggcagcttcaaggtaatcaaaattaaccttccatcttcttctccttaattcagttacttcactgtcttctggcagctcgatcgagcaaataaacgcacagcttctagttccatccatggcagcactgcaccatgaccattatgttcttgtttgagttcgctagcttctgtttgatatcaaagcatacattgccgcatgtgcagctagcagtgcatgagattaattctcttgcatctgctgcagatcagtaatgcaggggcatgaactttcctgcagcacctctgtgcagcaaataaactgttaaagagtacatggttaaataagcttttgccacatcgtctttgattaggcaaaaacattcagtatacacaacttccgacctttacaaattacaacagtaacttcagctataaattatagcacatgtgagttaattcgatggatggattcatgcatgtatatgtgtgcatatgcagtacgtgttgctggcgccgtgggtagcgcacgggtggtatgaggtggcgaccaaggggtggcgggaggtggatctcgggtacatcgccatcctcccgtcgttgctgctgcggatgctgcacaaccaagcctggatcaccatctcccgcctccaaaacgcccgtggccgccgccagattgttcgccgcggcatcgagttcgaccaggttgaccgcgagaggaactggtatgccaaacaccataaaattacgtacaacccacgcggtgtgttcgtggcggctagcttcaccttcgagattaattaattcaacctcattatagttgatgtgttgttacgtgtatggtggtgtgcgtgcagggacgaccagatcatcctgagcggtatcctactatacctcggcgcactgtacgtaccgggcgggcaacacttaccgctgtggaggacggatggcgcggggctgatcgccttgctgcatgcggggccagtggagttcctctactactggttccatcgtgcgttgcaccaccactttctctacacccactaccactcgcaccaccactcttcaatcgtcactgagcccatcacatgtacgtaattaattgccactagagacggtttatcctcgaggctccaaacattacattctcttttaggcaataacctttgagcttctatattagtatcgaattgtgttgcgtcataaatatttttacaaaatttttattcatcatctaaagttatcaatgatcaaagttcaatcaatactaatagttacaagtaatttgaaatagaggaagtaagttgtactacctagttgtaccatcattgctccaaacaacctattacatgatattactttcgtcccaaacctctaaatgaatattaagattttggtaatacaaattcttaaaattttgagacagaaatattactagacctgtaaccttgggataaattaaaccacggtaatcttccaatagaacaaagtaaaaaacaagtcttttccataaggacacaaaacaggaggtgtacttcgtcagatgcaagtgtcgcgcgtgtccgttcctcaggaaacacagagtgttcctgtggccagtcgatcgctacttcaattccctcctccttcaatgcatgcctgaacaataattgtaggcctagagagtgtgtgagttaaggaatgcaaaggacacacgatatttcatggaccattgagatcgaagtaagccgaccgatcgatcgcgagctaaatttatgtagcccatcgaatccgttgctgaatgcctgaccaaacggagaagcaaacgtggtccatgaacaacgtatcagagacttttagacaagagagaaatcacattctaaggggttttttcccccttttttttgagtggaagagttttttttattgagaggtatcgagaagtactatatttttcgtgtaagctagccaaatatcagtgcgttgcaacttgcaacggattattaaaaatagcaaaattaagtccttgttaaattttttttaaaaaaaaatggttgaaacacaacttttcatcttaaagaaacaaacaaaaatgccatgcttagaaaattaaagagctaaagtatagtacagtatatatagtacaggcgactctcccaaaccttaataccatggcccatatatcagtgacccaggccctgggcaaactggtccacggcccagggcctgagatgaaaggcccgatgagaaatatgcatttttactaggaataagtctatttttcctcctttcaaccatgtaactttgtgttgggccaaaatttccatggggcggcctaggccttggcctatttctgggtccgccccttatcagtgattgtggtgatggcagattcactaccaccactactatcttttaatagtagtaaagattttggtgtcatcttgtaattttaagatgtacaagacggtaccataaattgactttaaagtgatttgaatggatgtgtaatgggagaaatcgcttttcaaatgtaaaataatgcactacttgtattagtactaaattttacattagagaacacgatatattcagtgattcttgataaccataaaatccctttaagattatggtgttttctttaagtactgttaaaaaaaaaccaatagtgtctactggttacactgcagaagaagagaaccctgcagactgcagtatttgtaattgagcaagcagatacatatacctaaatgcatatatgttcattacctacaattcctaacgttgttgcagccgtcatccatccgtttgctgagctcgttgcctacgaattgctcttctcgatcccactgatcgcctgtgccttgactggaactgcttccataattgcattcgagatgtatttgatttacattgatttcatgaacaacatggggcactgcaacttcgagttggtacccagctggctcttcacatggttccctcctctcaagtatctcatgtacacgccatcgtaagtacttcatcaggctcttaataatacttccttcttccttaaatgtttgacgccgttgacttttttaaacatgtttgaccgttcgtcttattcaaaaacttttgtgaaatgtgtaaaactatatgtatacataaaagtatatttaacaataaatcaaatgatagaaaaagaattaataattatttaaatttttgaataagacgaacggtcaaatatttttaaaaaagtcaatggcatcaaatattttgggatggagggagtatgtaaaagagtaactttacagtttttaagaaagcataggggaagtaccatattttatattggagaaattttacggttttcagtatttcttttaagataaaggaggctttattgatcttggatacaatatactctaaaaccactcctgatatctgcatagctaggatgcacatggtctatagttattgaaaaagccaaataaaagaagatgatgtgcatgtcactctgcaaaataaataacttgatcatacatgctgttttcactgttataataatctgaacttatgtgatatattaggtttcattctctgcaccacactcagtttcggacaaactactcccttttcatgccgttctacgattatatctacaacaccatggacaagtcatcagacactctgtatgagaactcactgaaaaacaatgaggaagaagaagcagtggatgtggttcaccttacacacctgaccaccctgcattccatctaccacatgaggcccggtttcgccgaatttgcgtccaggccctacgtttccaggtggtacatgaggatgatgtggcctctgtcatggctctccatggtgctgacatggacgtacggttcttcattcactgttgagaggaatgtcatgaagaagatcaggatgcagtcatgggccataccaagatacagtttccatgtaagagtaaccatgttcagtgcatgattcacagatggtgtgcatgataaattgataatcaggttagaaacattttgttttgtgcagtatggattggattgggagaaggaagctatcaatgatcttatcgaaaaggcggtatgtgaagctgacaagaatggggctaaagttgtaagccttggactcctgaatcaggtagctcatttcctaatgaattcagagcaagttgaaacattatcatccatacttcagaattcagatgttagctatatgtccacatgtactgccaaattttagtcaagataaaacagttagtgcttaataattgtttatcttcagggaaaaggtttagtcataaaggtaggaaaataaaaaaattaagtagcaaagagtccgttgacagtagtccaacagaactaataaattctgtacatttcatgagaatacaatatgtagaaattagggaagtatgtactcatgcatggttgaactggtaattgacatacaatatcttcaatataaggcacataccctgaataaaagtggagaacaatatctgctgaaatacccaaagttgggagcaagaattgtcgatggaaccagcttagctgctgcagtggttgtcaacagtatcccccaaggcacagaccaagtaattcttgcaggaaatgtttccaaggtggcgcgtgctgtagcgcaagcattatgcaagaaaaatatcaaagtaattaatccactactcacctctgatttattttatagcatgcaaaaggataccatgttgtaacaaaccactattcttgtacaggtcacgatgacaaacaagcaagattatcatttactcaagccagaaataccagaaactgtagctgacaatctttcgttttcgaaaacaggcaccgcaaaggtaagaatagatttcctcatttttcctacattctctggacaaatgaatagaatgtataagagaaatatcattgcctaataaaccaaaaattttcaggtttggttaattggtgatggtctagattctgctgaacaattcagagcacagaaaggaactctgtttatcccatactcacaatttcctccaaagatggtacgcaaggacagctgcagctactcgacaactcctgcaatggctgtaccaaaaacgctgcagaatgtgcattcatgcgaggtagtagtaataacctgttgaaataatccagagattcagacgaacttcacatgatctaatcacaaaatttttgaactttttttttgacagaattggctgccaaggagggttatgagcgcatggcgaatcgcgggaattcttcatgcgttggagggatggaatgagcatgaatgtggtgacaaggtgcttgatatggacaaagtttggtctgctgcaattatgcatgggttctgcccagttgctcaaggttgatgattcagttgcaaagtatcagaataagttttagctggattatgctatgtggtcaccgtatcagaaagagagatgttctgttggcaagaagagatatagtatctgagtaatttcatctgccatggtttttaaaacattgttcatcatctcctttgatcaaagactggccatggctactttctgtataagtatctgtcctttttagtccatagtgtaattcagcaacaaaacactcttggcattgttatgcagtctcatgaatgtttttccagcatacggaattacgg</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0471100, RefSeq:Os10g0471100