Difference between revisions of "Os02g0274900"

From RiceWiki
Jump to: navigation, search
(References)
Line 6: Line 6:
  
 
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO: 0005215 GO: 0005215], [http://amigo.geneontology.org/amigo/term/GO: 0005351 GO: 0005351], [http://amigo.geneontology.org/amigo/term/GO: 0006810 GO: 0006810], [http://amigo.geneontology.org/amigo/term/GO: 0008643 GO: 0008643], [http://amigo.geneontology.org/amigo/term/GO: 0016020 GO: 0016020], [http://amigo.geneontology.org/amigo/term/GO: 0016021 GO: 0016021]
 
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO: 0005215 GO: 0005215], [http://amigo.geneontology.org/amigo/term/GO: 0005351 GO: 0005351], [http://amigo.geneontology.org/amigo/term/GO: 0006810 GO: 0006810], [http://amigo.geneontology.org/amigo/term/GO: 0008643 GO: 0008643], [http://amigo.geneontology.org/amigo/term/GO: 0016020 GO: 0016020], [http://amigo.geneontology.org/amigo/term/GO: 0016021 GO: 0016021]
 +
 +
===Mutation===
 +
[[File:OsGMST1_fig1.jpg|right|thumb|300px|''Salt tolerance test of ''OsGMST1'' antisense transgenic rice plants (from reference <ref name="ref1" />).'']]
 +
*There were no differences in the seed germination rate between WT and the transgenic lines without NaCl stress(Figure 1A). Treatment with 150 mM and 200 mM NaCl,however, reduced the germination rate of AS-L12 and ASL18(Figure 1A, B).
 +
*At 200 mM NaCl, the germination rate of the wild type was 90%, while the germination rates of the AS-L12 and AS-L18 lines were reduced to 40% and 50%,respectively (P <0.01) (Figure 1B), and this difference was maintained over several days (P <0.01) (Figure 1C).
 +
*Reduced expression of OsGMST1 also conferredreduced tolerance to salt stress in young seedlings(Figure 1D).
 +
*The survival rate of AS-L12 (40% and 20% in 150 mM NaCl and 200 mM NaCl, respectively) and ASL18 (50% and 30%) were lower than the WT (70% and 50%)with treatment of 150 mM and 200 mM NaCl (P <0.01)(Figure 1E).
 +
*By contrast, the tolerance of OsGMST1 antisense plants to PEG and cold stress was the same as that of WT plants (Figure 1F, G). Just as for SGB1, increased expression of OsGMST1 had no effect.
  
 
===Expression===
 
===Expression===

Revision as of 16:06, 21 December 2014

The rice OsGMST1 gene is a novel Golgi-localized monosaccharide transporter that may play a role in salt stress tolerance.[1]

Annotated Information

Function

OsGMST1 is a member of the monosaccharide transporter family in rice. It encodes a putative monosaccharide transporter.[1]
Monosaccharide transporters play a pivotal role in the translocation and distribution of monosaccharides throughout the plant.The mobility of sugars between source and sink tissues in plants depends on sugar transport proteins.[1][2] Hong Cao et al.speculates that this gene is a sugar transporter based on its sequence characteristics and the effect on the sugar content when the gene expression is reduced in rice.It is hypothesized that sugar homeostasis is affected in OsGMST1 knockdown transgenic rice, which putatively results in altered sugar contents, so the seedlings show a NaCl hypersensitive phenotype.

GO assignment(s): 0005215 GO: 0005215, 0005351 GO: 0005351, 0006810 GO: 0006810, 0008643 GO: 0008643, 0016020 GO: 0016020, 0016021 GO: 0016021

Mutation

File:OsGMST1 fig1.jpg
Salt tolerance test of OsGMST1 antisense transgenic rice plants (from reference [1]).
  • There were no differences in the seed germination rate between WT and the transgenic lines without NaCl stress(Figure 1A). Treatment with 150 mM and 200 mM NaCl,however, reduced the germination rate of AS-L12 and ASL18(Figure 1A, B).
  • At 200 mM NaCl, the germination rate of the wild type was 90%, while the germination rates of the AS-L12 and AS-L18 lines were reduced to 40% and 50%,respectively (P <0.01) (Figure 1B), and this difference was maintained over several days (P <0.01) (Figure 1C).
  • Reduced expression of OsGMST1 also conferredreduced tolerance to salt stress in young seedlings(Figure 1D).
  • The survival rate of AS-L12 (40% and 20% in 150 mM NaCl and 200 mM NaCl, respectively) and ASL18 (50% and 30%) were lower than the WT (70% and 50%)with treatment of 150 mM and 200 mM NaCl (P <0.01)(Figure 1E).
  • By contrast, the tolerance of OsGMST1 antisense plants to PEG and cold stress was the same as that of WT plants (Figure 1F, G). Just as for SGB1, increased expression of OsGMST1 had no effect.

Expression

Please input expression information here.

Subcellular localization

  • OsGMST1-GFP was co-expressed with the Golgi marker sialyltransferase (ST) tagged red fluorescence protein (RFP), most of the red and green fluorescence merged. The analysis by Hong Cao et al. suggests that OsGMST1 is localized on the Golgi apparatus [1].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. 1.0 1.1 1.2 1.3 1.4 Cao H, Guo S, Xu Y, et al. Reduced expression of a gene encoding a Golgi localized monosaccharide transporter (OsGMST1) confers hypersensitivity to salt in rice (Oryza sativa)[J]. Journal of experimental botany, 2011: err178.
  2. Reuscher S, Akiyama M, Yasuda T, et al. The Sugar Transporter Inventory Of Tomato: Genome-Wide Identification And Expression Analysis[J]. Plant and Cell Physiology, 2014: pcu052.

Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref4" defined in <references> is not used in prior text.


Structured Information

Gene Name

Os02g0274900

Description

Major facilitator superfamily protein

Version

NM_001053073.1 GI:115445516 GeneID:4328999

Length

6891 bp

Definition

Oryza sativa Japonica Group Os02g0274900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:10103586..10110476

Sequence Coding Region

10104106..10104187,10104289..10104369,10104522..10104551,10104627..10104759,10106009..10106108
,10106212..10106324,10106411..10106504,10107201..10107354,10107463..10107606
,10107702..10107775,10107849..10107937,10108711..10108825,10109581..10109763

Expression

GEO Profiles:Os02g0274900

Genome Context

<gbrowseImage1> name=NC_008395:10103586..10110476 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:10103586..10110476 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcggtggaagcttaagtcgtcggcgtacaagcgcgtgccgtccagggacgccgccatggatctcgacgtcgagacgccagcgaaaatggcggacggcggggccccgtcgtggcgcatgtcgctgccgcacgtgtgcgtcgccacgctcacctccttcctcttcggcttcgccgggaacaccctcgccgaaggccttgtggtgagcatctgcctgggtggtgcgtttgttgggtgcctgttcagtggatccatcgctgacggaatcggcaggcgtcgcgcgtttcagctcagtgcgctgcccatgatcatcggcgctgccgtaagcgctctcaccaatagtctggagggtatgcttcttggaagatttttggttggaacagggatgggattaggtccaccagtagcttcactgtacataacagaggtttctcctccttcagtgaggggcacatatgggagctttgttcagattgcaacctgccttggaatcgtagtatctctcctaattggtacacctgtgaaggatattgatagatggtggagggtgtgtttctgggttgcagctgttccagcaactttacaagctcttggaatggagttctgtgctgagagcccccagtggctgtataagtgtggaagaacgactgaagcagagatacaatttgaaaaacttctaggtcctcttcatgttaagtctgctatggcagaactctcccgatctgaaagaggcgatgatggagaaaatgtgaagtattcggaattgttttatggtcgcaactttaatgttgtttttattggcacaacgctctttgctttacaacagttatccggcataaattctgtgttctatttctcatcaactgtgttcagaagtgtgggtgtgccccctaaccttgcgaacatatgcatggggatagcaaatttatcaggctcaattgtagctatgcttctaatggacaaactaggaaggaaagtacttctttcagggagcttccttggcatggcctttgcaatgggacttcaggctgttggagcaaatcgtcaccaccttggttctgcaagcgtatatctttcagttggtggcatgctattgtttgtcttgacattttcgttaggagcaggtccagtgccaggacttcttttgcctgagattttcccaaacaaaatacgggccaaggctatggctctgtgcatgtccgtgcattgggtggtaaatttttttgtcagtttgttgttcttgcggcttctggagcaacttggtccacaagttctgtacacaatgttttcctcagcttgtgtggtagcagcaatatttgtgcggcgccatgtggttgaaacaaagggaaagactttgcaagagatagaagtttcgcttctacaaacacaataa</cdnaseq>

Protein Sequence

<aaseq>MRWKLKSSAYKRVPSRDAAMDLDVETPAKMADGGAPSWRMSLPH VCVATLTSFLFGFAGNTLAEGLVVSICLGGAFVGCLFSGSIADGIGRRRAFQLSALPM IIGAAVSALTNSLEGMLLGRFLVGTGMGLGPPVASLYITEVSPPSVRGTYGSFVQIAT CLGIVVSLLIGTPVKDIDRWWRVCFWVAAVPATLQALGMEFCAESPQWLYKCGRTTEA EIQFEKLLGPLHVKSAMAELSRSERGDDGENVKYSELFYGRNFNVVFIGTTLFALQQL SGINSVFYFSSTVFRSVGVPPNLANICMGIANLSGSIVAMLLMDKLGRKVLLSGSFLG MAFAMGLQAVGANRHHLGSASVYLSVGGMLLFVLTFSLGAGPVPGLLLPEIFPNKIRA KAMALCMSVHWVVNFFVSLLFLRLLEQLGPQVLYTMFSSACVVAAIFVRRHVVETKGK TLQEIEVSLLQTQ</aaseq>

Gene Sequence

<dnaseqindica>521..602#704..784#937..966#1042..1174#2424..2523#2627..2739#2826..2919#3616..3769#3878..4021#4117..4190#4264..4352#5126..5240#5996..6178#aaaggaaccaacagaagcaaaggtggcattcgttcgtcgcacgagagcaccacagcctcacgacacgagctcatcccccgccatctccgctccgctcctctcctctcctctccgtgctacgccaccaaacccactccccccgagatagagagagagagagagagagatccacagcctcacagcatcaaatcacctcccctttctcccagatccaagccgccgccaccaccccctcgccgtcgccgtcgccccctccggccgatctgatgcccgcgcacgcggcggtggtggtcaggtaactttgtaggccgcctcctcctcgattttttgatttttttttcttctcatgtgctaaccacgccacgccaccaccgctattaatacatccccgaggcgagtgtcgaggcatttaccaccagatcgatctcgccttccgctttcccaaatccctagactgacctcctcctgctgctgcttgcgttgcgttgcgttgcgttgtctctttctccgatcagcgccgatgcggtggaagcttaagtcgtcggcgtacaagcgcgtgccgtccagggacgccgccatggatctcgacgtcgagacgccaggtccgtgcacggttttttctctttttttttccctgcgatttttttttgggtggtgagattttgaggttttttttttctgtgctcggtggcggtttctgcagcgaaaatggcggacggcggggccccgtcgtggcgcatgtcgctgccgcacgtgtgcgtcgccacgctcacctccttcctcttcggctaccactccgggtgcgtgccatccattttctcatttcttcttctggttgtggttgttttcccaactcacggtgtggagcgcgtgcgtgtgattggttggtttggtgcagggtcgtgaacgagccgctcgagagcatctccaccgacctcggcttcgccgggaacaccctcgccgaaggtaagtaagcagccacgattcgggtgaaatttgatgttattgggcatgggagcaattgggtgtcctgtgtttcaggccttgtggtgagcatctgcctgggtggtgcgtttgttgggtgcctgttcagtggatccatcgctgacggaatcggcaggcgtcgcgcgtttcagctcagtgcgctgcccatgatcatcggcgctgccgtaaggtaattcgtggtgtcccacttctgttgacggctacttcctctcaatccttagtccatgcgtggtaatttgtggtgtcacacttctgttgatggctacttcctctgaatccttagtccatgtgtggtaatccatggcatcacacttctgttgatggtcacttccactaaatcctagtccatgtgcagtttggtcagtttggaatgtatttaattgccacttgctagcatttcttattttctagctggagttgttggtttcttggtgttaaacaaataaggtcagtggccactggtagcctggtttcttgttggtattgtatactttatttggaaagttgaatgttgggaacaacaaacttactctttcttatgtatcatattgatatattggtggtgtgacaagtagtagcttgatggattcgtccttccatgggattttgaatctccgagttatgtaggagatgaataaaatgtgtggtcctcttaacacagtgcagagagtagtatattgagaatactaggtttgccatcccgccattaggtaaatttatatggtttcttcgactgactgtggagctagtgtaacttcacatgcaaacatgaaagcaatcgaactttacgataaattgactttcactagccacaatagactgaagagtactgaaaattaattacacgcatcttctagaaaaccatggctcaatagtaaatattcttttcttaattgcgctcatgatgtacttagattgattatccttaaaaagggaaaagttctagcctttcaataattcaacactcttattaattgatagctagtgtacgttttggatatagcataccaagtcacttatgggtgttaagtcttggtttatttattggtgctgtagagttgctgataagttgaataataacaacataaaccatatgtgctctgattaccttgaggtgcttttacattgccattgctacatggcatccacaaactaaagttcacttaagtgcattgaatgataatatttaagatgctaacctttttttgaatctttagcacttttatcttctgcatgttatttaataggatccgttttggtagttgcaccaagactgttatttccgaaaatgcaattgtgtaatacttacatctatgagcacctaatacttgagagctgccggaaggaactatgcctgaacttagttattcctatgattctgtttcattgaaccttcctgaagaagaaacattttgcagcgctctcaccaatagtctggagggtatgcttcttggaagatttttggttggaacagggatgggattaggtccaccagtagcttcactgtacataacagaggtatgtaattggtgttatgcacctatgcctcaatctctgattgtctgtatcaaatattaatcttattcatttgtacctttttcttataatcccttggatccaggtttctcctccttcagtgaggggcacatatgggagctttgttcagattgcaacctgccttggaatcgtagtatctctcctaattggtacacctgtgaaggatattgatagatggttagatgctttcttctgtagctctctacatgttttgtgtagttagtaaatctgatgcatctaactttatcctttgctattaacaggtggagggtgtgtttctgggttgcagctgttccagcaactttacaagctcttggaatggagttctgtgctgagagcccccagtggctgtataaggtgtgtttatcttgggggaagctgcttattttctatctatgatcttccaacttaaatcacccttcaggtgtctgattctctataattgtgcttcggcaaatttgatcttaagtgcctttgctagtcgtaaaatgagatactcatatttgaggaccatcttggagtcactttgtcggaaacgacatttgatctcttaaactatatgcaaataccacatgctgatttttccatgaatgtttgaaggtcactgtcgtattaaatcaaacaattaatctgttggttagaacttgcaatctaccatcatcctgaggttttttgtgcttacaattaataatgggttgacacaaacttattgcctattgttacttagatggtaacacgaatgatatctatagaagagtagtccattggcacatattggtatttgcttcagaaagcacacattagattttcggataaatatcgttgatctttagtttcctcaatactgtgcctgttttctgattgtgcaccatgcaaatacagctctgatatgagcaaaacattttattagttttttttctgagaaaaccaattctcaacacagacttatacaactcccatacttctttatattggcaatttgtattgacatatttatatttaacttgtagcacatacattgaaaattattgacgagtcttatcttttattcagtgtggaagaacgactgaagcagagatacaatttgaaaaacttctaggtcctcttcatgttaagtctgctatggcagaactctcccgatctgaaagaggcgatgatggagaaaatgtgaagtattcggaattgttttatggtcgcaactttaatggtacaagctgttatgtgttttccattctgttgtgtatttgcgctaaactataaccttatttatgtttggccttgaagtttgttcattacaagtccctttttgctacagttgtttttattggcacaacgctctttgctttacaacagttatccggcataaattctgtgttctatttctcatcaactgtgttcagaagtgtgggtgtgccccctaaccttgcgaacatatgcatggggatagcaaatttatcaggtgggctcattggagcatcttctctttttttctgttgttctactgttctgttatattgatggttgatggattttgtttgatgtgtttgcttccaggctcaattgtagctatgcttctaatggacaaactaggaaggaaagtacttctttcagggagcttccttggcatggtaagctatcactgtgattggaacttggaagataatgttgaacattactcactgcacatctttactgctataggcctttgcaatgggacttcaggctgttggagcaaatcgtcaccaccttggttctgcaagcgtatatctttcagttggtggcatgctattgtaagttttagaattttatgtcttccgttactttgattctactatctttcaagttatctgaatttagttattaatgtctaggaggctaaactaaatagctgtgactactagttgaataccttaagcaggaggttttatgctcctattggttaagccaatttatgctacatttttgtgccaaatgtgccaatatcaggcttaaaaatatgcaaaattctctacttattgtatctacaaataggattttttttatggtgctctaaatttgttcagaccatccatttcacatcaacccaaaggatatcatttctcttatacctcattagaggtaatagattataagaaggatggaaacaaattattcaacctgatacaaaacattgttgcgtataaattcttccaagaacttgttcaggcaaccttttggttgcatatggtggaacaattctgtgtcaatatatcgatctgacatgtaaatggcactggggatatcagttgcatacatgatattgttctgctttgcagttgtttcattttgattcccctgacttcaccctcagcgttgttgtgcatccttagttattctttatatgaacaatagggctttccatttggtttaatttgtaactagttaaattatgagacagtttacctttatgctgctcttagcagaactctttaattgttcctgacaattatactttactggctcattaagtacaaatgttatggtaagtctaccagtttcttatagttgagtgcttctttttcaggtttgtcttgacattttcgttaggagcaggtccagtgccaggacttcttttgcctgagattttcccaaacaaaatacgggccaaggctatggctctgtgcatgtccgtgcattgggtaaggagttatgtttccatcacaaaaaaaaaaagacactgcatgtctgtgcattggataggagttcatttttcatcctcaaaaaatagacactgcatgtcaaaatgctggcagttagatcaaacagtgaaattcaacgtggaaatttcgttgctgattttcactttttggtttaatatgttaatatttggtattatgtgtctatgcatgtttcctgttccattaggatgtttaaaaatatgttactgctagtatgtaaccatagctgttcacattgttcaatgataaaaggagcctagtgctaaatacctggtgaagaatttgagctgttgtttagtcaggctgagctagaacaggtatattagatcaattcaaaatattcaagctgctaagtcctcaatagcatttccacactgttttaccaaccctggttatggtaatgaagatcagaatttcagaagtatatttgactctgtaagctgcagctttctctgtgtaacaaaatcgtttcccccaatcgccataagataaaaggtactgtatgctgttaataataaatgaataatggggccagatttttaaattagataataaaaaacttagacatttcgatatggttgattatgtaatggtaaatgataagtgtagggttgcaacaataatttggtagggcgcactatttacttgccatggttcattgtagttctaccatgattcgtatcgacgtcttgacatgctatgcttaaatgctgcaggtggtaaatttttttgtcagtttgttgttcttgcggcttctggagcaacttggtccacaagttctgtacacaatgttttcctcagcttgtgtggtagcagcaatatttgtgcggcgccatgtggttgaaacaaagggaaagactttgcaagagatagaagtttcgcttctacaaacacaataaaggtgctaatcttattctgaatctgacaacacaatttggatctgttaatctgtcttatctaatcttgtctttaacgtggcaattttttatttaaaggtggtttgcgagttgcgatgcacatttgaaactcacaagatgaactgcctggatttttagttgatatttcatatggccatgttgatagcaagcttggttttggaacttgatgatttaccatgtggtattcaggattaacaagcagcaatactctttcattgcagatttcatcagcgagtttgaggcaacaacaacctacatgattagcatctgacactatacttgttgctgaatacctgctgggaaagtctaccgtgaaagttgatcactgaaccaagccaacataccacggacaggcagcgccctacactggaccagggaagtacccagacatgcacctgtgaccagtaagggcgacctagctcgtgcataaaccatccatgtagtgaggttgcatctgtatagttggtcttctgctagatgtatctggtaatctgtgttgtcttcatcatttgtcatttgtacactgtcagtatggagaaaaaaagacgggaagtgtggttactgatggccatagtttgaaccgtggatacgttttttttactgtttaaagaggaataacagcactggctctgccagctacatgaaaataaagtgcgttctgcctgagctaattt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0274900, RefSeq:Os02g0274900