Difference between revisions of "Os08g0323700"
(→Function) |
(→Annotated Information) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ''Xiang-Qiang Kong et al.'' have cloned an Oryza sativa cDNA encoding for a member of the cation–Cl- cotransporter (CCC) family. Plant CCC proteins are highly conserved and that they have greater sequence similarity to the sub-family of animal K+ –Cl- cotransporters than to other cation–Cl- cotransporters. In plants CCCs are involved in the homeostasis of Cl-.<ref name="ref1" /><ref name="ref2" />)<br> | |
| − | ''OsCCC1'' was primarily involved in K+ homeostasis and Cl- homeostasis, it might be an K+ -Cl- cotransporter. It is a compact phylogenetic cluster with highly conserved genes that shows the highest similarity to animal KCCs. ''OsCCC1'' plays a significant role in ion homeostasis and rice development under saline conditions. The analysis of ''OsCCC1'' RNAi lines designed by | + | ''OsCCC1'' was primarily involved in K+ homeostasis and Cl- homeostasis, it might be an K+ -Cl- cotransporter. It is a compact phylogenetic cluster with highly conserved genes that shows the highest similarity to animal KCCs. ''OsCCC1'' plays a significant role in ion homeostasis and rice development under saline conditions. The analysis of ''OsCCC1'' RNAi lines designed by ''Xiang-Qiang Kong et al.'' strongly suggests its involvement in pivotal developmental processes.<ref name="ref1" /> |
===WT plants VS. Transgenic plants=== | ===WT plants VS. Transgenic plants=== | ||
Revision as of 05:42, 23 December 2014
The rice OsCCC1 is a member of the cation-Cl- cotransporter (CCC) family and plays a significant role in K+ and Cl－ homeostasis and rice plant development.[1])
Contents
Annotated Information
Function
Xiang-Qiang Kong et al. have cloned an Oryza sativa cDNA encoding for a member of the cation–Cl- cotransporter (CCC) family. Plant CCC proteins are highly conserved and that they have greater sequence similarity to the sub-family of animal K+ –Cl- cotransporters than to other cation–Cl- cotransporters. In plants CCCs are involved in the homeostasis of Cl-.[1][2])
OsCCC1 was primarily involved in K+ homeostasis and Cl- homeostasis, it might be an K+ -Cl- cotransporter. It is a compact phylogenetic cluster with highly conserved genes that shows the highest similarity to animal KCCs. OsCCC1 plays a significant role in ion homeostasis and rice development under saline conditions. The analysis of OsCCC1 RNAi lines designed by Xiang-Qiang Kong et al. strongly suggests its involvement in pivotal developmental processes.[1]
WT plants VS. Transgenic plants
Expression
Please input expression information here.
Subcellular localization
Evolution
Please input evolution information here.
Knowledge Extension
You can also add sub-section(s) at will.
Labs working on this gene
- Kay Lab of Plant Stress Research, School of Life Science, Shandong Normal University, 250014 Jinan, Shandong Province, People’s Republic of China
- Cotton Research Center, Shandong Academy of Agricultural Sciences, 250100 Jinan, Shandong Province, People’s Republic of China
References
- ↑ 1.0 1.1 1.2 Kong X Q, Gao X H, Sun W, et al. Cloning and functional characterization of a cation–chloride cotransporter gene OsCCC1[J]. Plant molecular biology, 2011, 75(6): 567-578.
- ↑ Colmenero‐Flores J M, Martínez G, Gamba G, et al. Identification and functional characterization of cation–chloride cotransporters in plants[J]. The Plant Journal, 2007, 50(2): 278-292.
Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Structured Information
| Gene Name |
Os08g0323700 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001068078.1 GI:115475893 GeneID:4345272 |
| Length |
1383 bp |
| Definition |
Oryza sativa Japonica Group Os08g0323700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:14274176..14275558 |
| Sequence Coding Region |
14274636..14275556 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:14274176..14275558 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:14274176..14275558 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ctggccgaggatgcaaagactgcttgtcgtcagctggacacttacattgagtacaaacgctgtgagggtgttgcagagattattgtagcgccatcaatgtctgagggcttccgcagcattgttcagaccatgggtctaggtaacttgaagcccaacattattgtgatgcggtaccctgagatttggcgtcgcgagaatctgatacagataccgtcaacatttgttagcataataaatgattgcattattgctaacaaagccgttgtcattgtgaagggccttgatgagtggcctaatgagtaccagagacagtacggcactattgacctctactggattgtgagagatggaggattgatgcttcttctgtctcagctcctgctcacaaaagagacctttgaaagctgcaaaatccaagtgttctgcatagcagaggaggatactgatgctgaggagctgaaggctgacgtcaaaaagttcttgtatgatcttcgaatgcatgctgaggtcatcgtcgtgactatgaagtcatgggaacctcatatggagagcagtagcagtggtgctccacaggacgattctcaagaggcttacacaagtgcacagcgaaggatcagcacatacctctctgagatgaaggaaactgcacaaagagaaggacatccactaatggaggacggaaagcaagtagttgtgaatgaacagaagattgagaaattcctctatacaatgttcaagctgaactcgacaatacttaggtactccagaatggcagctgtggtcctcgtaagcctccctccaccaccattaaatcaccctgcgtatttctacatggagtacatggatctgcttgtagagaacgtcccacgcatgttgatagttaggggatacagaagagatgttgtcacattcttcacatga</cdnaseq> |
| Protein Sequence |
<aaseq>LAEDAKTACRQLDTYIEYKRCEGVAEIIVAPSMSEGFRSIVQTM GLGNLKPNIIVMRYPEIWRRENLIQIPSTFVSIINDCIIANKAVVIVKGLDEWPNEYQ RQYGTIDLYWIVRDGGLMLLLSQLLLTKETFESCKIQVFCIAEEDTDAEELKADVKKF LYDLRMHAEVIVVTMKSWEPHMESSSSGAPQDDSQEAYTSAQRRISTYLSEMKETAQR EGHPLMEDGKQVVVNEQKIEKFLYTMFKLNSTILRYSRMAAVVLVSLPPPPLNHPAYF YMEYMDLLVENVPRMLIVRGYRRDVVTFFT</aaseq> |
| Gene Sequence |
<dnaseqindica>3..923#aactggccgaggatgcaaagactgcttgtcgtcagctggacacttacattgagtacaaacgctgtgagggtgttgcagagattattgtagcgccatcaatgtctgagggcttccgcagcattgttcagaccatgggtctaggtaacttgaagcccaacattattgtgatgcggtaccctgagatttggcgtcgcgagaatctgatacagataccgtcaacatttgttagcataataaatgattgcattattgctaacaaagccgttgtcattgtgaagggccttgatgagtggcctaatgagtaccagagacagtacggcactattgacctctactggattgtgagagatggaggattgatgcttcttctgtctcagctcctgctcacaaaagagacctttgaaagctgcaaaatccaagtgttctgcatagcagaggaggatactgatgctgaggagctgaaggctgacgtcaaaaagttcttgtatgatcttcgaatgcatgctgaggtcatcgtcgtgactatgaagtcatgggaacctcatatggagagcagtagcagtggtgctccacaggacgattctcaagaggcttacacaagtgcacagcgaaggatcagcacatacctctctgagatgaaggaaactgcacaaagagaaggacatccactaatggaggacggaaagcaagtagttgtgaatgaacagaagattgagaaattcctctatacaatgttcaagctgaactcgacaatacttaggtactccagaatggcagctgtggtcctcgtaagcctccctccaccaccattaaatcaccctgcgtatttctacatggagtacatggatctgcttgtagagaacgtcccacgcatgttgatagttaggggatacagaagagatgttgtcacattcttcacatgattagagatgtataccttctggcggctctactgccatatgattgttgtaacatcatcatagcaaagtgggcaagcagattttgtgcagattttacagctgaaagtcagaagccatcaccttgaaggctacctaccctgagataggagatctgctgggcctttcgctggcatattgggtacgtcaactacagtatgtccattctttttctcggattcacatagcaagcttcaatacagttaattgtcacaaattttgtagccctggtgttccccatacgtgtaacaatcttagaaacgcaacgcttccttttgcactgaaacagtagcaatggtatcacattttttaaaatatatttccagttgatgtaatgagcaaactgaggtggccattaatgttggcatgttgttgattggcatgacgtttatactgatacacgtgaaaatcagctgaaattattggt</dnaseqindica> |
| External Link(s) |
