Difference between revisions of "Os01g0859300"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
As a bZIP transcription factor,''OsABI5'' could regulate the adaptive stress response and plant fertility of rice<ref name="ref1"/><ref name="ref2"/>.
 
 
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
 +
===Mutation===
  
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
 +
 +
===Subcellular localization===
 +
  
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.
  
You can also add sub-section(s) at will.
+
 
 +
===Knowledge Extension===
 +
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
Key Laboratory of Molecular and Developmental Biology, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, P.O. Box 2707, South 1-3, Zhongguancun, Beijing 100080, P.R. China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Zou M, Guan Y, Ren H, et al. A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance[J]. Plant molecular biology, 2008, 66(6): 675-683.
 +
</ref>
 +
* <ref name="ref2">
 +
Zou M, Guan Y, Ren H, et al. Characterization of alternative splicing products of bZIP transcription factors OsABI5[J]. Biochemical and biophysical research communications, 2007, 360(2): 307-313.
 +
</ref>
 +
* <ref name="ref3">
 +
Brocard I M, Lynch T J, Finkelstein R R. Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response[J]. Plant Physiology, 2002, 129(4): 1533-1543.
 +
</ref>
 +
* <ref name="ref4">
 +
Gampala S S L, Finkelstein R R, Sun S S M, et al. ABI5 interacts with abscisic acid signaling effectors in rice protoplasts[J]. Journal of Biological Chemistry, 2002, 277(3): 1689-1694.</ref>
 +
</ref>
 +
* <ref name="ref5">
 +
Lu G, Gao C, Zheng X, et al. Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice[J]. Planta, 2009, 229(3): 605-615.
 +
</ref>
 +
<references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 00:59, 24 December 2014

As a bZIP transcription factor,OsABI5 could regulate the adaptive stress response and plant fertility of rice[1][2].

Annotated Information

Function

Please input function information here.

Mutation

Expression

Please input expression information here.

Subcellular localization

Evolution

Please input evolution information here.


Knowledge Extension

Labs working on this gene

Key Laboratory of Molecular and Developmental Biology, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, P.O. Box 2707, South 1-3, Zhongguancun, Beijing 100080, P.R. China

References

<references>

</ref>

<references>

Structured Information

Gene Name

Os01g0859300

Description

Similar to ABA response element binding factor (Fragment)

Version

NM_001051401.1 GI:115441172 GeneID:4325061

Length

1601 bp

Definition

Oryza sativa Japonica Group Os01g0859300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:38930631..38932231

Sequence Coding Region

38930632..38931408,38931497..38931568,38931692..38931721,38931864..38931956

Expression

GEO Profiles:Os01g0859300

Genome Context

<gbrowseImage1> name=NC_008394:38930631..38932231 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:38930631..38932231 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>tccatgaacatggacgagtttgtggctaacatatggaatgctgaagaattccaggctaccaccggaggttgcaagggtgccatggaggaagccaaggtggtagacagtggaagcggaagcggtgatgcaggaggaagcggtttatgtcggcagggatcattttccttgccgctaccgctgtgccagaagacggtggaggaggtgtggactgagatcaaccaagcccctgcacacacctccgctccggcctccgcgctccagccacatgccgggagcggtggtgttgcagctaacgaccgacaggtaacactaggtgagatgacacttgaggatttcttggtaaaggccggggtggtccgagggtcctttaccgggcaagcggccatgggatctggcatggtcaacgggccggtgaaccccatgcagcagggccaaggcggtcctatgatgttcccagtaggaccggtaaacgccatgtatccggtgatgggtgatggcatggggtaccccggtgggtacaacgggatggcgattgtgccaccgccacctcccgcccaaggtgccatggttgtcgtgagtcctggatcatcagatgggatgagtgccatgacacatgctgatatgatgaattgtattgggaatgggatgatgattgagaatggaacaagaaagcgtccccacagagaggatggctgcgccgagaagacggtggagcgccgccaacggcgcatgatcaagaaccgtgagtcagctgcacggtcccgtgctagaaagcaggcttatacggtggagctcgaagctgaactgaactatctcaagcaggagaacgctcgtctcaaagaggcagagaagacggttctactgacaaagaagcaaatgctggttgagaaaatgatggagcagtccaaggagaagatgaatgcaaataggggtggcagccagctgcgccgcagcggcagctgcatgtggtga</cdnaseq>

Protein Sequence

<aaseq>SMNMDEFVANIWNAEEFQATTGGCKGAMEEAKVVDSGSGSGDAG GSGLCRQGSFSLPLPLCQKTVEEVWTEINQAPAHTSAPASALQPHAGSGGVAANDRQV TLGEMTLEDFLVKAGVVRGSFTGQAAMGSGMVNGPVNPMQQGQGGPMMFPVGPVNAMY PVMGDGMGYPGGYNGMAIVPPPPPAQGAMVVVSPGSSDGMSAMTHADMMNCIGNGMMI ENGTRKRPHREDGCAEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQEN ARLKEAEKTVLLTKKQMLVEKMMEQSKEKMNANRGGSQLRRSGSCMW</aaseq>

Gene Sequence

<dnaseqindica>2..778#867..938#1062..1091#1234..1326#ttccatgaacatggacgagtttgtggctaacatatggaatgctgaagaattccaggctaccaccggaggttgcaagggtgccatggaggaagccaaggtggtagacagtggaagcggaagcggtgatgcaggaggaagcggtttatgtcggcagggatcattttccttgccgctaccgctgtgccagaagacggtggaggaggtgtggactgagatcaaccaagcccctgcacacacctccgctccggcctccgcgctccagccacatgccgggagcggtggtgttgcagctaacgaccgacaggtaacactaggtgagatgacacttgaggatttcttggtaaaggccggggtggtccgagggtcctttaccgggcaagcggccatgggatctggcatggtcaacgggccggtgaaccccatgcagcagggccaaggcggtcctatgatgttcccagtaggaccggtaaacgccatgtatccggtgatgggtgatggcatggggtaccccggtgggtacaacgggatggcgattgtgccaccgccacctcccgcccaaggtgccatggttgtcgtgagtcctggatcatcagatgggatgagtgccatgacacatgctgatatgatgaattgtattgggaatgggatgatgattgagaatggaacaagaaagcgtccccacagagaggatggctgcgccgagaagacggtggagcgccgccaacggcgcatgatcaagaaccgtgagtcagctgcacggtcccgtgctagaaagcaggtacacatgttgctccgaaccttttagtttctatgtatcgttaagacattttgcatggagattgaaatttttatgaataatgctacaggcttatacggtggagctcgaagctgaactgaactatctcaagcaggagaacgctcgtctcaaagaggcagaggtattaaagcaagaaacattatccactcagctttcattgtcattcctaaacagtctcgttccttccttttctgtaacattgaactgataaatatacaatgtctatattatcttccttttacagaagacggttctactgacaaagaagcaaatggtattgtcctctcccatgtggcaatccccattccgcatagtgctcatcgttttgtgaaattattaaatacatatttgttattcatttatttgtgtgtgtatatatgctcatggaaatatgtcgtgttcctgtgatttttcagctggttgagaaaatgatggagcagtccaaggagaagatgaatgcaaataggggtggcagccagctgcgccgcagcggcagctgcatgtggtgaaacgggcatagcggtgaccggcgagtggcacactcatcctgcttctggtgtggcactagcctctgaggctctgaagaggatttgcacattaagtcttctttcagactaagtgatgtgaaggtattatggtagtagttgatatacatatatgctgtgatgcttgtaaacctgcctggacccacatgtcttgccatcgtgttcaccggtccttgctgcttatatggttacatgtcgctgtttgtacaaaacaacgatgaataaaattatacaatagt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0859300, RefSeq:Os01g0859300

  1. 1.0 1.1 Zou M, Guan Y, Ren H, et al. A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance[J]. Plant molecular biology, 2008, 66(6): 675-683.
  2. 2.0 2.1 Zou M, Guan Y, Ren H, et al. Characterization of alternative splicing products of bZIP transcription factors OsABI5[J]. Biochemical and biophysical research communications, 2007, 360(2): 307-313.
  3. Brocard I M, Lynch T J, Finkelstein R R. Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response[J]. Plant Physiology, 2002, 129(4): 1533-1543.
  4. Gampala S S L, Finkelstein R R, Sun S S M, et al. ABI5 interacts with abscisic acid signaling effectors in rice protoplasts[J]. Journal of Biological Chemistry, 2002, 277(3): 1689-1694.
  5. Lu G, Gao C, Zheng X, et al. Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice[J]. Planta, 2009, 229(3): 605-615.