Difference between revisions of "Os01g0859300"
| Line 1: | Line 1: | ||
| − | + | As a bZIP transcription factor,''OsABI5'' could regulate the adaptive stress response and plant fertility of rice<ref name="ref1"/><ref name="ref2"/>. | |
| − | |||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
| + | |||
| + | ===Mutation=== | ||
===Expression=== | ===Expression=== | ||
Please input expression information here. | Please input expression information here. | ||
| + | |||
| + | ===Subcellular localization=== | ||
| + | |||
===Evolution=== | ===Evolution=== | ||
Please input evolution information here. | Please input evolution information here. | ||
| − | + | ||
| + | ===Knowledge Extension=== | ||
| + | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | Key Laboratory of Molecular and Developmental Biology, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, P.O. Box 2707, South 1-3, Zhongguancun, Beijing 100080, P.R. China | |
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | Zou M, Guan Y, Ren H, et al. A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance[J]. Plant molecular biology, 2008, 66(6): 675-683. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Zou M, Guan Y, Ren H, et al. Characterization of alternative splicing products of bZIP transcription factors OsABI5[J]. Biochemical and biophysical research communications, 2007, 360(2): 307-313. | ||
| + | </ref> | ||
| + | * <ref name="ref3"> | ||
| + | Brocard I M, Lynch T J, Finkelstein R R. Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response[J]. Plant Physiology, 2002, 129(4): 1533-1543. | ||
| + | </ref> | ||
| + | * <ref name="ref4"> | ||
| + | Gampala S S L, Finkelstein R R, Sun S S M, et al. ABI5 interacts with abscisic acid signaling effectors in rice protoplasts[J]. Journal of Biological Chemistry, 2002, 277(3): 1689-1694.</ref> | ||
| + | </ref> | ||
| + | * <ref name="ref5"> | ||
| + | Lu G, Gao C, Zheng X, et al. Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice[J]. Planta, 2009, 229(3): 605-615. | ||
| + | </ref> | ||
| + | <references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 00:59, 24 December 2014
As a bZIP transcription factor,OsABI5 could regulate the adaptive stress response and plant fertility of rice[1][2].
Contents
Annotated Information
Function
Please input function information here.
Mutation
Expression
Please input expression information here.
Subcellular localization
Evolution
Please input evolution information here.
Knowledge Extension
Labs working on this gene
Key Laboratory of Molecular and Developmental Biology, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, P.O. Box 2707, South 1-3, Zhongguancun, Beijing 100080, P.R. China
References
<references>
</ref>
<references>
Structured Information
| Gene Name |
Os01g0859300 |
|---|---|
| Description |
Similar to ABA response element binding factor (Fragment) |
| Version |
NM_001051401.1 GI:115441172 GeneID:4325061 |
| Length |
1601 bp |
| Definition |
Oryza sativa Japonica Group Os01g0859300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:38930631..38932231 |
| Sequence Coding Region |
38930632..38931408,38931497..38931568,38931692..38931721,38931864..38931956 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:38930631..38932231 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:38930631..38932231 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>tccatgaacatggacgagtttgtggctaacatatggaatgctgaagaattccaggctaccaccggaggttgcaagggtgccatggaggaagccaaggtggtagacagtggaagcggaagcggtgatgcaggaggaagcggtttatgtcggcagggatcattttccttgccgctaccgctgtgccagaagacggtggaggaggtgtggactgagatcaaccaagcccctgcacacacctccgctccggcctccgcgctccagccacatgccgggagcggtggtgttgcagctaacgaccgacaggtaacactaggtgagatgacacttgaggatttcttggtaaaggccggggtggtccgagggtcctttaccgggcaagcggccatgggatctggcatggtcaacgggccggtgaaccccatgcagcagggccaaggcggtcctatgatgttcccagtaggaccggtaaacgccatgtatccggtgatgggtgatggcatggggtaccccggtgggtacaacgggatggcgattgtgccaccgccacctcccgcccaaggtgccatggttgtcgtgagtcctggatcatcagatgggatgagtgccatgacacatgctgatatgatgaattgtattgggaatgggatgatgattgagaatggaacaagaaagcgtccccacagagaggatggctgcgccgagaagacggtggagcgccgccaacggcgcatgatcaagaaccgtgagtcagctgcacggtcccgtgctagaaagcaggcttatacggtggagctcgaagctgaactgaactatctcaagcaggagaacgctcgtctcaaagaggcagagaagacggttctactgacaaagaagcaaatgctggttgagaaaatgatggagcagtccaaggagaagatgaatgcaaataggggtggcagccagctgcgccgcagcggcagctgcatgtggtga</cdnaseq> |
| Protein Sequence |
<aaseq>SMNMDEFVANIWNAEEFQATTGGCKGAMEEAKVVDSGSGSGDAG GSGLCRQGSFSLPLPLCQKTVEEVWTEINQAPAHTSAPASALQPHAGSGGVAANDRQV TLGEMTLEDFLVKAGVVRGSFTGQAAMGSGMVNGPVNPMQQGQGGPMMFPVGPVNAMY PVMGDGMGYPGGYNGMAIVPPPPPAQGAMVVVSPGSSDGMSAMTHADMMNCIGNGMMI ENGTRKRPHREDGCAEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQEN ARLKEAEKTVLLTKKQMLVEKMMEQSKEKMNANRGGSQLRRSGSCMW</aaseq> |
| Gene Sequence |
<dnaseqindica>2..778#867..938#1062..1091#1234..1326#ttccatgaacatggacgagtttgtggctaacatatggaatgctgaagaattccaggctaccaccggaggttgcaagggtgccatggaggaagccaaggtggtagacagtggaagcggaagcggtgatgcaggaggaagcggtttatgtcggcagggatcattttccttgccgctaccgctgtgccagaagacggtggaggaggtgtggactgagatcaaccaagcccctgcacacacctccgctccggcctccgcgctccagccacatgccgggagcggtggtgttgcagctaacgaccgacaggtaacactaggtgagatgacacttgaggatttcttggtaaaggccggggtggtccgagggtcctttaccgggcaagcggccatgggatctggcatggtcaacgggccggtgaaccccatgcagcagggccaaggcggtcctatgatgttcccagtaggaccggtaaacgccatgtatccggtgatgggtgatggcatggggtaccccggtgggtacaacgggatggcgattgtgccaccgccacctcccgcccaaggtgccatggttgtcgtgagtcctggatcatcagatgggatgagtgccatgacacatgctgatatgatgaattgtattgggaatgggatgatgattgagaatggaacaagaaagcgtccccacagagaggatggctgcgccgagaagacggtggagcgccgccaacggcgcatgatcaagaaccgtgagtcagctgcacggtcccgtgctagaaagcaggtacacatgttgctccgaaccttttagtttctatgtatcgttaagacattttgcatggagattgaaatttttatgaataatgctacaggcttatacggtggagctcgaagctgaactgaactatctcaagcaggagaacgctcgtctcaaagaggcagaggtattaaagcaagaaacattatccactcagctttcattgtcattcctaaacagtctcgttccttccttttctgtaacattgaactgataaatatacaatgtctatattatcttccttttacagaagacggttctactgacaaagaagcaaatggtattgtcctctcccatgtggcaatccccattccgcatagtgctcatcgttttgtgaaattattaaatacatatttgttattcatttatttgtgtgtgtatatatgctcatggaaatatgtcgtgttcctgtgatttttcagctggttgagaaaatgatggagcagtccaaggagaagatgaatgcaaataggggtggcagccagctgcgccgcagcggcagctgcatgtggtgaaacgggcatagcggtgaccggcgagtggcacactcatcctgcttctggtgtggcactagcctctgaggctctgaagaggatttgcacattaagtcttctttcagactaagtgatgtgaaggtattatggtagtagttgatatacatatatgctgtgatgcttgtaaacctgcctggacccacatgtcttgccatcgtgttcaccggtccttgctgcttatatggttacatgtcgctgtttgtacaaaacaacgatgaataaaattatacaatagt</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Zou M, Guan Y, Ren H, et al. A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance[J]. Plant molecular biology, 2008, 66(6): 675-683.
- ↑ 2.0 2.1 Zou M, Guan Y, Ren H, et al. Characterization of alternative splicing products of bZIP transcription factors OsABI5[J]. Biochemical and biophysical research communications, 2007, 360(2): 307-313.
- ↑ Brocard I M, Lynch T J, Finkelstein R R. Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response[J]. Plant Physiology, 2002, 129(4): 1533-1543.
- ↑ Gampala S S L, Finkelstein R R, Sun S S M, et al. ABI5 interacts with abscisic acid signaling effectors in rice protoplasts[J]. Journal of Biological Chemistry, 2002, 277(3): 1689-1694.
- ↑ Lu G, Gao C, Zheng X, et al. Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice[J]. Planta, 2009, 229(3): 605-615.