Difference between revisions of "Os01g0571300"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
Please input one-sentence summary here.
+
''OsHsfA7'' is a number of heat shock protein (HSP) genes in rice, which play an important role in plant stress tolerance and mainly regulated by heat shock transcription factors (Hsfs) <ref name="ref1"/><ref name="ref2"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
 +
===Mutation===
 +
  
 
===Expression===
 
===Expression===
Line 11: Line 14:
 
Please input evolution information here.
 
Please input evolution information here.
  
−
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University
 +
*College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, 410128, China
 +
*Department of Plant Molecular Biology, University of Delhi, South Campus, Benito Juarez Road, Dhaula Kuan, New Delhi 110 021, India
 +
*Division of Health Sciences, Graduate School of Medical Science, Kanazawa University, Japan
 +
*Crop Gene Engineering Key Laboratory of Hunan Province, Hunan Agricultural University, Furong District, Room 420, Life Science Building, Changsha (410128)
 +
*Institute of Rice Science, Hunan Agricultural University, Changsha, 410128
 +
*Directorate of Rice Research, Hyderabad, Andhra Pradesh, India
 +
*Centre for Biotechnology, Institute of Science & Technology, Jawaharlal Nehru Technological University, Hyderabad, India
 +
*Crop Gene Engineering Key Laboratory of Hunan Province, Hunan Agricultural University, Changsha City, Hunan Province, China
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Chauhan H, Khurana N, Agarwal P, et al. Heat shock factors in rice (Oryza sativa L.): genome-wide expression analysis during reproductive development and abiotic stress[J]. Molecular Genetics and Genomics, 2011, 286(2): 171-187.
 +
</ref>
 +
* <ref name="ref2">
 +
Liu A L, Liu C F, Zhang X W, et al. BMB Reports: Over-expression of OsHsfA7 enhanced salt and drought tolerance in transgenic rice[J]. Biochemistry and Molecular Biology Reports, 2013, 46(1): 31-36.
 +
</ref>
 +
* <ref name="ref3">
 +
Mittal D, Enoki Y, Lavania D, et al. Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.)[J]. FEBS Journal, 2011, 278(17): 3076-3085.
 +
</ref>
 +
* <ref name="ref4">
 +
Liu A, Zou J, Zhang X, et al. Transcriptional Profiling of Class A Rice Heat Stress Transcription Factor Genes (OsHsfAs) under Abiotic Stress[J].
 +
</ref>
 +
* <ref name="ref5">
 +
Sailaja B, Anjum N, Prasanth V V, et al. Comparative Study of Susceptible and Tolerant Genotype Reveals Efficient Recovery and Root System Contributes to Heat Stress Tolerance in Rice[J]. Plant Molecular Biology Reporter, 2014: 1-13.
 +
</ref>
 +
* <ref name="ref6">
 +
Liu A L, Zou J, Zhang X W, et al. Expression profiles of class A rice heat shock transcription factor genes under abiotic stresses[J]. Journal of Plant Biology, 2010, 53(2): 142-149.
 +
</ref>
 +
* <ref name="ref7">
 +
Mittal D, Chakrabarti S, Sarkar A, et al. Heat shock factor gene family in rice: genomic organization and transcript expression profiling in response to high temperature, low temperature and oxidative stresses[J]. Plant Physiology and Biochemistry, 2009, 47(9): 785-795.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 12:06, 26 December 2014

OsHsfA7 is a number of heat shock protein (HSP) genes in rice, which play an important role in plant stress tolerance and mainly regulated by heat shock transcription factors (Hsfs) [1][2].

Annotated Information

Function

Please input function information here.

Mutation

Expression

Please input expression information here.

Evolution

Please input evolution information here.

Knowledge Extension

Labs working on this gene

  • Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University
  • College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, 410128, China
  • Department of Plant Molecular Biology, University of Delhi, South Campus, Benito Juarez Road, Dhaula Kuan, New Delhi 110 021, India
  • Division of Health Sciences, Graduate School of Medical Science, Kanazawa University, Japan
  • Crop Gene Engineering Key Laboratory of Hunan Province, Hunan Agricultural University, Furong District, Room 420, Life Science Building, Changsha (410128)
  • Institute of Rice Science, Hunan Agricultural University, Changsha, 410128
  • Directorate of Rice Research, Hyderabad, Andhra Pradesh, India
  • Centre for Biotechnology, Institute of Science & Technology, Jawaharlal Nehru Technological University, Hyderabad, India
  • Crop Gene Engineering Key Laboratory of Hunan Province, Hunan Agricultural University, Changsha City, Hunan Province, China

References

  1. ↑ Chauhan H, Khurana N, Agarwal P, et al. Heat shock factors in rice (Oryza sativa L.): genome-wide expression analysis during reproductive development and abiotic stress[J]. Molecular Genetics and Genomics, 2011, 286(2): 171-187.
  2. ↑ Liu A L, Liu C F, Zhang X W, et al. BMB Reports: Over-expression of OsHsfA7 enhanced salt and drought tolerance in transgenic rice[J]. Biochemistry and Molecular Biology Reports, 2013, 46(1): 31-36.

Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref4" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref5" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref6" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref7" defined in <references> is not used in prior text.


Structured Information

Gene Name

Os01g0571300

Description

Similar to Heat shock transcription factor 31 (Fragment)

Version

NM_001049913.1 GI:115437775 GeneID:4326351

Length

2933 bp

Definition

Oryza sativa Japonica Group Os01g0571300, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:23595710..23598642

Sequence Coding Region

23595711..23596172,23597579..23598325

Expression

GEO Profiles:Os01g0571300

Genome Context

<gbrowseImage1> name=NC_008394:23595710..23598642 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:23595710..23598642 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcttaaaccccaaacacctcgcgctcgccgcgccgcgcatcccaattcccacatggcgtcctcctcctcctcctcctccctctgccgactactcatccccaggccgaccacccgccgcttctccggaggaggaggggaggggggaatggcggcggcggcgccggtgaagcgggaggtgaagcccgaggcgggggaggggtggggcgggggtgatctgggggtggtgccgccgccgccgcggccgatggaggggctcggggaggcggggccggcgccgttcgtggcgaagacgtacgagatggtggcggacgcggccaccgacgcggtggtgtcgtgggggcccggcggctcgggggcctccttcgtggtgtgggacccgcacgcgctcgccgccggcgtgctcccgcgcttcttcaagcacgccaacttctcctccttcgttcgccagctcaacacctacgggttccgaaaggtcactccagatcggtgggagtttgcaaatgaagccttcttagctggtcagaagcatttgctgaaaaacatcaagaggaggcgtgtttccaagcctctcgtggattcacaactaagaaataaagcaagtgttgtttttggacagcctgaggctcctggtgaggttgtgagcttgaagagagaccgtgcagccctcagagctgaggtcatcatgcttaagcagcagtacaacgcctgtaaatctcagctcattgccatggaggagatggtccgcaacatcgagagaaggcaacagcagaccatcggcttctttgccaaggtactcaccaacccggctttcgtgcagcaggttctactcaactatgtgaataagaatggcctaagaggcgccgcgaaaagacaacggctgatggaaaacgaagaacagcatgctgattcgccattgaacaaaggtatggaagctgcatctgtgatggaagctgatgtttctccagggagcactggctgtggcacagttgggaaagtggagaccactccaatgtgcaatttccagaatattgagaatatgtgtgatgatgtctgggaagagctggacgccttacctgaaactggaatggagcaggaagaaaaggctgggattggctccttcgatgtcgaggagttcgtcggaaggccttgtggttgggttgatgactgcccataccttgtggagccgatgcagttcgtggaacactag</cdnaseq>

Protein Sequence

<aaseq>MLKPQTPRARRAAHPNSHMASSSSSSSLCRLLIPRPTTRRFSGG GGEGGMAAAAPVKREVKPEAGEGWGGGDLGVVPPPPRPMEGLGEAGPAPFVAKTYEMV ADAATDAVVSWGPGGSGASFVVWDPHALAAGVLPRFFKHANFSSFVRQLNTYGFRKVT PDRWEFANEAFLAGQKHLLKNIKRRRVSKPLVDSQLRNKASVVFGQPEAPGEVVSLKR DRAALRAEVIMLKQQYNACKSQLIAMEEMVRNIERRQQQTIGFFAKVLTNPAFVQQVL LNYVNKNGLRGAAKRQRLMENEEQHADSPLNKGMEAASVMEADVSPGSTGCGTVGKVE TTPMCNFQNIENMCDDVWEELDALPETGMEQEEKAGIGSFDVEEFVGRPCGWVDDCPY LVEPMQFVEH</aaseq>

Gene Sequence

<dnaseqindica>2..463#1870..2616#aatgcttaaaccccaaacacctcgcgctcgccgcgccgcgcatcccaattcccacatggcgtcctcctcctcctcctcctccctctgccgactactcatccccaggccgaccacccgccgcttctccggaggaggaggggaggggggaatggcggcggcggcgccggtgaagcgggaggtgaagcccgaggcgggggaggggtggggcgggggtgatctgggggtggtgccgccgccgccgcggccgatggaggggctcggggaggcggggccggcgccgttcgtggcgaagacgtacgagatggtggcggacgcggccaccgacgcggtggtgtcgtgggggcccggcggctcgggggcctccttcgtggtgtgggacccgcacgcgctcgccgccggcgtgctcccgcgcttcttcaagcacgccaacttctcctccttcgttcgccagctcaacacctacgtacgtatcccaatcgcccgatctgctgcttgtggtgtgggtggtgttctttctgtgaaccgctgatcggtctcgtgtgcttctgtttcccgtgtaaattgaatcgttgatgctggtgagacaatagttgttagttgatcgaacaagataactgattatgagaatgaaatttgaaaaggagtgataccaaattcgtgggaaatccttgctgcgtttccgtactaatcaagaatcgtatcatgtatgaactggtactgtcctatgctgtggtttgttcgtgtccacgaatgcgctcgcatatacaatatcctgttttgtcaaaattggtgataatagcaggagaattctagaagtttgaccagaatttaaaaatcatgcctaaattggttaatattggactgcaaatggtatagaaccatcccttgtatatacaattttgttccacctctagtttaggatggtgcataccagaaattttgtcttaccaagaaactgaaatcctcagccatgtttttgtaggatgctgaatgttcagtggtggtatacttgtattgtacgatgcaaagtcatgctagttacttgcatccatctgtactacgggacaaatgtttgtcttggtttttagcccctttgtgatgatgcacttggattggatttcatctgctccactgtcactggatatgacctatgttctgtctgttcacgttgcaatccaagatactgatccctaaaatacttaaagtggataatattccttcttgtgggcattacaagtgtccaggtagctcgtatgtcgtactcgaaatcttgaagtctttttccaccactctgaaagacctaatacctcatgacctgtccatacctttaatagttaaaagggaaaggtgatggtaacatgatctaggtgaactatgctcccccactttttcttttgtcttttttgatgatgtggagctccgtgcttttgtacatacatgagcttatctgattcaatgagctacagaagtacagaacagttaccttgttcttgtcaatgagcttatctagcagtgtgttctcggttatttggcctgtttgtgtttattgctaatggcaccaccattcttgctgttttgatattatctatatacttttcttgctgtaaatagacatttcatatcaggcaactgaaccttctagcttctgggtaatgctggtcctgtggttcaacggtagaacacagaagtgaaattgctagtttaatctctgatagactaaaaccatagactgattcttttgttaatatgcgtatacctaccattgacagttttcaatccctaaatactgctgactttctagactgggtttggttccctgcagctgcttctagaaaaacttaccggcctctacctgttgttgctatgcaggggttccgaaaggtcactccagatcggtgggagtttgcaaatgaagccttcttagctggtcagaagcatttgctgaaaaacatcaagaggaggcgtgtttccaagcctctcgtggattcacaactaagaaataaagcaagtgttgtttttggacagcctgaggctcctggtgaggttgtgagcttgaagagagaccgtgcagccctcagagctgaggtcatcatgcttaagcagcagtacaacgcctgtaaatctcagctcattgccatggaggagatggtccgcaacatcgagagaaggcaacagcagaccatcggcttctttgccaaggtactcaccaacccggctttcgtgcagcaggttctactcaactatgtgaataagaatggcctaagaggcgccgcgaaaagacaacggctgatggaaaacgaagaacagcatgctgattcgccattgaacaaaggtatggaagctgcatctgtgatggaagctgatgtttctccagggagcactggctgtggcacagttgggaaagtggagaccactccaatgtgcaatttccagaatattgagaatatgtgtgatgatgtctgggaagagctggacgccttacctgaaactggaatggagcaggaagaaaaggctgggattggctccttcgatgtcgaggagttcgtcggaaggccttgtggttgggttgatgactgcccataccttgtggagccgatgcagttcgtggaacactagaggcatgagaagaatacaatctgtccttagaatagtggaacgtgtttataacgtctgaatatctgtatatcaattacccacttcgatagaagtctgtactatgaatagcataagctcctggaacagagcttaaatataggaaacgaacactctcaggtaatgcaagccaggagtttgtaggattgaagatttgttactgtaaattctgctgggcgcagcaaaaaaatcgtgatgttagatatacaatactgtctctgcaatgtagccgaggaaaaatacgaatgccagtcttatcaatgtgaatactttatactgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0571300, RefSeq:Os01g0571300

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0571300&oldid=184469"