Difference between revisions of "Os03g0395000"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
OsHO2 has a potential regulatory role for tetrapyrrole biosynthesis in rice. <ref name="ref1" />
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File: Shijc-Os03g0395000-Fig1.gif|right|thumb|200px|'' Tetrapyrrole biosynthesis pathway in plants. The carbon skeleton of tetrapyrroles is derived from glutamate. (from reference <ref name="ref1" />).'']]
 +
In higher plants, a major regulatory mechanism for tetrapyrrole metabolism has been attributed to the feedback inhibition of HEMA (glutamyl tRNA reductase) by heme <ref name="ref2" />(Beale 1999). HEMA catalyzes the first committed step of tetrapyrrole biosynthesis by generating the immediate precursor (i.e. glutamate 1-semialdehyde) of ALA. Disruption of HO1 or PΦB synthase genes is believed to cause over-accumulation of heme which in turn represses HEMA activities and ALA formation <ref name="ref3" />(Tanaka et al. 2011). However, our Osho2 mutants showed decreased levels of heme but increased levels of ALA, indicating that the Chl deficiency was not a consequence of heme-induced HEMA inhibition. In addition, the levels of Proto IX (the last common precursor of Chl and PΦB), Pchlide and Chlide (Chl precursors), and BV (PΦB precursor) were all diminished in the mutant seedlings, presumably reflecting the overall reduction of metabolic flux toward Chl and PΦB production. Interestingly, the Osho2 mutants were found to accumulate elevated levels of Mg-Proto IX, which is the first committed Chl precursor. Meanwhile, the accumulation of transcripts encoding different tetrapyrrole enzymes was consistent with the corresponding metabolite changes. Thus, the expression levels of PPOX (for Proto IX), MgCY (for Pchlide), POR (for Chlide), FeCh (for Heme), and HO1/YGL2 (for BV) were down-regulated while the expression levels of HEMA (for ALA) and CHLI, CHLD, and CHLH (for Mg-Proto IX) were up-regulated in the mutant seedlings.
 +
The biosynthesis of different tetrapyrrole-derived biomolecules is under sophisticated controls to meet specific cellular demands and to prevent excessive accumulation of photosensitizing intermediates <ref name="ref3" />(Tanaka et al. 2011). For example, chlorophyll biosynthesis is often subject to coordinated transcriptional regulation of genes encoding key enzymes like HEMA1, CHLH, MgMT, MgCy, POR, and CAO <ref name="ref4" /> (Waters et al. 2009). Interestingly, the expression of HEMA1 and MgCH genes (CHLI, CHLD, and CHLH) appears to be regulated independently from other tetrapyrrole biosynthesis genes in our Osho2 mutants which accumulated higher levels of ALA and Mg-Proto IX. These unique changes in metabolite and transcript levels suggest the existence of a novel regulatory mechanism, potentially involving OsHO2, for tetrapyrrole biosynthesis, especially during early developmental stages in rice. Instead of binding to heme, the synthetic AtHO2 recombinant protein binds Proto IX with high affinity in vitro, implicating a regulatory role on substrate flow through binding of tetrapyrrole intermediates <ref name="ref5" />(Gisk et al. 2010). On the other hand, Arabidopsis GUN4 stimulates MgCH activities by binding to the CHLH subunit as well as the enzyme substrate (Proto IX) and product (Mg-Proto IX) <ref name="ref6" />(Adhikari et al. 2011). Meanwhile, OsHO2 may regulate tetrapyrrole biosynthesis through interaction with tetrapyrrole metabolites and/or enzymes inside chloroplasts. Further investigations involving metabolite binding and protein–protein interaction analyses will be necessary to elucidate the biochemical activities of OsHO2.
 +
 
 +
===Mutation===
 +
[[File: Shijc-Os03g0395000-Fig2.gif|right|thumb|200px|'' Phenotypes of the ylc2 mutant. (from reference <ref name="ref1" />).'']]
 +
The ylc2 mutant was identified by screening of a population of rice 60Coγ-irradiated mutants in our laboratory. The chlorosis phenotype was most prominent during the seedling stage (Fig. 2a). In field-grown mutant plants, the mature leaves showed darker green pigmentation but newly emerged leaves were still pale in color (Fig. 2b). Chl contents of WT and ylc2 mutant seedlings (1-week-old) were then measured to characterize the chlorosis mutant phenotype. As shown in Fig. 2c, the contents of Chl a, Chl b, and total Chl in mutant seedlings were 18, 27, and 23 % of those measured in WT Nipponbare plants. The amount of total carotenoids was also reduced by more than 65 % in the ylc2 seedlings. The ultrastructure of chloroplasts was then examined using transmission electron microscopy (TEM). In WT plants, the chloroplasts showed well-developed thylakoid membrane with stacks of grana (Fig. 2d). However, the thylakoid membrane system in the mutant chloroplasts is poorly organized with larger numbers of plastoglobules, indicating that chloroplast development is defective in the ylc2 seedlings.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File: Shijc-Os03g0395000-Fig3.gif|right|thumb|200px|'' Subcellular localization of the YLC2 (OsHO2)-EYFP fusion protein transiently expressed in N. benthamiana leaves by Agrobacterium infiltration. (from reference <ref name="ref1" />).'']]
 +
To elucidate the subcellular localization of the OsHO2 protein, a translational fusion with enhanced yellow fluorescent protein (EYFP) at the C-terminus driven by the CaMV 35S promoter was constructed for Agrobacterium-mediated transient expression in N. benthamiana. As revealed by confocal microscopy analysis, the OsHO2-EYFP fluorescent signals were detected in organelles of mesophyll cells consistent with the sizes and chlorophyll autofluorescence of chloroplasts (Fig. 4a). The sub-organelle location of OsHO2-EYFP was further examined by immunoblot analyses of stromal and membrane fractions from Percoll-purified chloroplasts of infiltrated N. benthamiana leaves. As shown in Fig. 4c, the OsHO2-EYFP fusion protein was only detected in the stromal fraction. Therefore, the above analyses suggested that OsHO2 is a chloroplast protein residing inside the stroma.
 +
[[File: Shijc-Os03g0395000-Fig4.gif|right|thumb|200px|''Gene expression analysis of OsHO2. (from reference <ref name="ref1" />).'']]
 +
Gene expression of OsHO2 in different tissues was first examined in the publicly available Affymetrix GeneChip microarray data. YLC2 expression was detected in almost all tissues of rice with highest levels detected in leaves and shoot apical meristem (Fig. 5a). Levels of OsHO2 expression were then compared in ylc2 mutant and WT seedlings using RT-PCR. Results indicated that the gene expression was not affected by the 8-bp deletion in ylc2 mutant (Fig. 5b). On the other hand, OsHO2 transcript accumulation in WT plants was reduced by approximately 50–60 % in mature leaves (third leaf) of 12-week-old plants in comparison to newly emerged leaves or young seedlings (Fig. 5c), further suggesting that the rice gene plays a more important role during early development.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: Shijc-Os03g0395000-Fig5.png|right|thumb|200px|'' Phylogenetic relationships of OsHO1, OsHO2 and their closely related homologs. (from reference <ref name="ref1" />).'']]
  
You can also add sub-section(s) at will.
+
BLAST search in the rice genome revealed that Os03g27770 is a single-copy gene with an ORF of 993 bp. The coding region contains 4 exons (3 introns) and encodes a protein of 330 amino acids with a molecular weight of approximately 36.5 kDa. The 8-bp deletion in ylc2 generated a frame-shift mutation, resulting in premature translational termination. Consequently, the ylc2 mutant protein is identical to the WT sequence up to the 244th position, followed by a short stretch of 15 amino acid residues (Fig. S2). The WT protein harbors a predicted N-terminal chloroplast-targeted sequence of 47 amino acids (www.cbs.dtu.dk/service/TargetP). The rice protein is annotated as heme oxygenase 2 (HO2) which contains a heme oxygenase (HO) domain (Pfam 01126) in the second half of the protein (176th–325th residues). Pairwise 3D structural alignment <ref name="ref7" /> (Gelly et al. 2011) demonstrated the tight superimposition of the mutant protein with OsHO2 except for the absence of three C-terminal α-helices (Fig. S3) which may be important for OsHO2 functions.
 +
The HO signature sequence which includes the His residue required for protein stability <ref name="ref8" /> (Matera et al. 1997) is conserved in OsHO2 (His-246). The His residue involved in HO-ascorbic acid binding <ref name="ref8" /> (Matera et al. 1997) can also be identified (His-254). However, the His residue essential for heme binding in HO is replaced by Arg-102 in OsHO2. Phylogeny analysis of plant HO homologous sequences clearly revealed the separation of the HO1 and HO2 subfamilies (Fig. S4). OsHO2 is clustered with two highly conserved sequences from maize and sorghum in the HO2 family. These cereal sequences share more than 75 % identity but are only weakly homologous to the dicot HO2 sequences with less than 50 % identity. By contrast, the HO1 sequences are highly homologous between monocot and dicot species. For example, OsHO1 shares 70 % sequence identity to the Arabidopsis HO1.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
1. State Key Laboratory Breeding Base for Zhejiang Sustainable Pest and Disease Control, Institute of Crops and Nuclear Technology Utilization, Zhejiang Academy of Agricultural Sciences, Hangzhou, 310021, China
 +
2. School of Biological Sciences, The University of Hong Kong, Pokfulam, Hong Kong, China
 +
3. College of Life and Environmental Sciences, Hangzhou Normal University, Hangzhou, 311121, China
 +
4. Department of Biology, Concordia University, Montreal, QC, H4B 1R6, Canada
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1"> Qingzhu Li, Fu-Yuan Zhu, Xiaoli Gao, Yi Sun, Sujuan Li, Yuezhi Tao, Clive Lo, Hongjia Liu (2014) Young Leaf Chlorosis 2 encodes the stroma-localized heme oxygenase 2 which is required for normal tetrapyrrole biosynthesis in rice. Planta 10.1007/s00425-014-2116-0 </ref>
 +
<ref name="ref2">Beale SI (1999) Enzymes of chlorophyll biosynthesis. Photosynth Res 60:43–73 </ref>
 +
<ref name="ref3">Tanaka R, Kobayashi K, Masuda T (2011) Tetrapyrrole metabolism in Arabidopsis thaliana. The Arabidopsis Book 9:e0145</ref>
 +
<ref name="ref4"> Waters MT, Wang P, Korkaric M, Capper RG, Saunders NJ, Langdale JA (2009) GLK transcription factors coordinate expression of the photosynthetic apparatus in Arabidopsis. Plant Cell 21:1109–1128 </ref>
 +
<ref name="ref5"> Gisk B, Yasui Y, Kohchi T, Frankenberg-Dinkel N (2010) Characterization of the haem oxygenase protein family in Arabidopsis thaliana reveals a diversity of functions. Biochem J 425:425–434 </ref>
 +
<ref name="ref6"> Adhikari ND, Froehlich JE, Strand DD, Buck SM, Kramer DM, Larkin RM (2011) GUN4-porphyrin complexes bind the ChlH/GUN5 subunit of Mg-Chelatase and promote chlorophyll biosynthesis in Arabidopsis. Plant Cell 23:1449–1467
 +
</ref>
 +
<ref name="ref7">Gelly JC, Joseph AP, Srinivasan N, De Brevern AG (2011) iPBA: a tool for protein structure comparison using sequence alignment strategies. Nucleic Acids Res 39:18–23 </ref>
 +
<ref name="ref8">Matera KM, Zhou H, Migita CT, Hobert SE, Ishikawa K, Katakura K, Maeshima H, Yoshida T, Ikeda-Saito M (1997) Histidine-132 does not stabilize a distal water ligand and is not an important residue for the enzyme activity in heme oxygenase-1. Biochemistry 36:4909–4915</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 13:46, 27 December 2014

OsHO2 has a potential regulatory role for tetrapyrrole biosynthesis in rice. [1]

Annotated Information

Function

Tetrapyrrole biosynthesis pathway in plants. The carbon skeleton of tetrapyrroles is derived from glutamate. (from reference [1]).

In higher plants, a major regulatory mechanism for tetrapyrrole metabolism has been attributed to the feedback inhibition of HEMA (glutamyl tRNA reductase) by heme [2](Beale 1999). HEMA catalyzes the first committed step of tetrapyrrole biosynthesis by generating the immediate precursor (i.e. glutamate 1-semialdehyde) of ALA. Disruption of HO1 or PΦB synthase genes is believed to cause over-accumulation of heme which in turn represses HEMA activities and ALA formation [3](Tanaka et al. 2011). However, our Osho2 mutants showed decreased levels of heme but increased levels of ALA, indicating that the Chl deficiency was not a consequence of heme-induced HEMA inhibition. In addition, the levels of Proto IX (the last common precursor of Chl and PΦB), Pchlide and Chlide (Chl precursors), and BV (PΦB precursor) were all diminished in the mutant seedlings, presumably reflecting the overall reduction of metabolic flux toward Chl and PΦB production. Interestingly, the Osho2 mutants were found to accumulate elevated levels of Mg-Proto IX, which is the first committed Chl precursor. Meanwhile, the accumulation of transcripts encoding different tetrapyrrole enzymes was consistent with the corresponding metabolite changes. Thus, the expression levels of PPOX (for Proto IX), MgCY (for Pchlide), POR (for Chlide), FeCh (for Heme), and HO1/YGL2 (for BV) were down-regulated while the expression levels of HEMA (for ALA) and CHLI, CHLD, and CHLH (for Mg-Proto IX) were up-regulated in the mutant seedlings. The biosynthesis of different tetrapyrrole-derived biomolecules is under sophisticated controls to meet specific cellular demands and to prevent excessive accumulation of photosensitizing intermediates [3](Tanaka et al. 2011). For example, chlorophyll biosynthesis is often subject to coordinated transcriptional regulation of genes encoding key enzymes like HEMA1, CHLH, MgMT, MgCy, POR, and CAO [4] (Waters et al. 2009). Interestingly, the expression of HEMA1 and MgCH genes (CHLI, CHLD, and CHLH) appears to be regulated independently from other tetrapyrrole biosynthesis genes in our Osho2 mutants which accumulated higher levels of ALA and Mg-Proto IX. These unique changes in metabolite and transcript levels suggest the existence of a novel regulatory mechanism, potentially involving OsHO2, for tetrapyrrole biosynthesis, especially during early developmental stages in rice. Instead of binding to heme, the synthetic AtHO2 recombinant protein binds Proto IX with high affinity in vitro, implicating a regulatory role on substrate flow through binding of tetrapyrrole intermediates [5](Gisk et al. 2010). On the other hand, Arabidopsis GUN4 stimulates MgCH activities by binding to the CHLH subunit as well as the enzyme substrate (Proto IX) and product (Mg-Proto IX) [6](Adhikari et al. 2011). Meanwhile, OsHO2 may regulate tetrapyrrole biosynthesis through interaction with tetrapyrrole metabolites and/or enzymes inside chloroplasts. Further investigations involving metabolite binding and protein–protein interaction analyses will be necessary to elucidate the biochemical activities of OsHO2.

Mutation

Phenotypes of the ylc2 mutant. (from reference [1]).

The ylc2 mutant was identified by screening of a population of rice 60Coγ-irradiated mutants in our laboratory. The chlorosis phenotype was most prominent during the seedling stage (Fig. 2a). In field-grown mutant plants, the mature leaves showed darker green pigmentation but newly emerged leaves were still pale in color (Fig. 2b). Chl contents of WT and ylc2 mutant seedlings (1-week-old) were then measured to characterize the chlorosis mutant phenotype. As shown in Fig. 2c, the contents of Chl a, Chl b, and total Chl in mutant seedlings were 18, 27, and 23 % of those measured in WT Nipponbare plants. The amount of total carotenoids was also reduced by more than 65 % in the ylc2 seedlings. The ultrastructure of chloroplasts was then examined using transmission electron microscopy (TEM). In WT plants, the chloroplasts showed well-developed thylakoid membrane with stacks of grana (Fig. 2d). However, the thylakoid membrane system in the mutant chloroplasts is poorly organized with larger numbers of plastoglobules, indicating that chloroplast development is defective in the ylc2 seedlings.

Expression

Subcellular localization of the YLC2 (OsHO2)-EYFP fusion protein transiently expressed in N. benthamiana leaves by Agrobacterium infiltration. (from reference [1]).

To elucidate the subcellular localization of the OsHO2 protein, a translational fusion with enhanced yellow fluorescent protein (EYFP) at the C-terminus driven by the CaMV 35S promoter was constructed for Agrobacterium-mediated transient expression in N. benthamiana. As revealed by confocal microscopy analysis, the OsHO2-EYFP fluorescent signals were detected in organelles of mesophyll cells consistent with the sizes and chlorophyll autofluorescence of chloroplasts (Fig. 4a). The sub-organelle location of OsHO2-EYFP was further examined by immunoblot analyses of stromal and membrane fractions from Percoll-purified chloroplasts of infiltrated N. benthamiana leaves. As shown in Fig. 4c, the OsHO2-EYFP fusion protein was only detected in the stromal fraction. Therefore, the above analyses suggested that OsHO2 is a chloroplast protein residing inside the stroma.

Gene expression analysis of OsHO2. (from reference [1]).

Gene expression of OsHO2 in different tissues was first examined in the publicly available Affymetrix GeneChip microarray data. YLC2 expression was detected in almost all tissues of rice with highest levels detected in leaves and shoot apical meristem (Fig. 5a). Levels of OsHO2 expression were then compared in ylc2 mutant and WT seedlings using RT-PCR. Results indicated that the gene expression was not affected by the 8-bp deletion in ylc2 mutant (Fig. 5b). On the other hand, OsHO2 transcript accumulation in WT plants was reduced by approximately 50–60 % in mature leaves (third leaf) of 12-week-old plants in comparison to newly emerged leaves or young seedlings (Fig. 5c), further suggesting that the rice gene plays a more important role during early development.

Evolution

Phylogenetic relationships of OsHO1, OsHO2 and their closely related homologs. (from reference [1]).

BLAST search in the rice genome revealed that Os03g27770 is a single-copy gene with an ORF of 993 bp. The coding region contains 4 exons (3 introns) and encodes a protein of 330 amino acids with a molecular weight of approximately 36.5 kDa. The 8-bp deletion in ylc2 generated a frame-shift mutation, resulting in premature translational termination. Consequently, the ylc2 mutant protein is identical to the WT sequence up to the 244th position, followed by a short stretch of 15 amino acid residues (Fig. S2). The WT protein harbors a predicted N-terminal chloroplast-targeted sequence of 47 amino acids (www.cbs.dtu.dk/service/TargetP). The rice protein is annotated as heme oxygenase 2 (HO2) which contains a heme oxygenase (HO) domain (Pfam 01126) in the second half of the protein (176th–325th residues). Pairwise 3D structural alignment [7] (Gelly et al. 2011) demonstrated the tight superimposition of the mutant protein with OsHO2 except for the absence of three C-terminal α-helices (Fig. S3) which may be important for OsHO2 functions. The HO signature sequence which includes the His residue required for protein stability [8] (Matera et al. 1997) is conserved in OsHO2 (His-246). The His residue involved in HO-ascorbic acid binding [8] (Matera et al. 1997) can also be identified (His-254). However, the His residue essential for heme binding in HO is replaced by Arg-102 in OsHO2. Phylogeny analysis of plant HO homologous sequences clearly revealed the separation of the HO1 and HO2 subfamilies (Fig. S4). OsHO2 is clustered with two highly conserved sequences from maize and sorghum in the HO2 family. These cereal sequences share more than 75 % identity but are only weakly homologous to the dicot HO2 sequences with less than 50 % identity. By contrast, the HO1 sequences are highly homologous between monocot and dicot species. For example, OsHO1 shares 70 % sequence identity to the Arabidopsis HO1.

Labs working on this gene

1. State Key Laboratory Breeding Base for Zhejiang Sustainable Pest and Disease Control, Institute of Crops and Nuclear Technology Utilization, Zhejiang Academy of Agricultural Sciences, Hangzhou, 310021, China 2. School of Biological Sciences, The University of Hong Kong, Pokfulam, Hong Kong, China 3. College of Life and Environmental Sciences, Hangzhou Normal University, Hangzhou, 311121, China 4. Department of Biology, Concordia University, Montreal, QC, H4B 1R6, Canada

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Qingzhu Li, Fu-Yuan Zhu, Xiaoli Gao, Yi Sun, Sujuan Li, Yuezhi Tao, Clive Lo, Hongjia Liu (2014) Young Leaf Chlorosis 2 encodes the stroma-localized heme oxygenase 2 which is required for normal tetrapyrrole biosynthesis in rice. Planta 10.1007/s00425-014-2116-0
  2. Beale SI (1999) Enzymes of chlorophyll biosynthesis. Photosynth Res 60:43–73
  3. 3.0 3.1 Tanaka R, Kobayashi K, Masuda T (2011) Tetrapyrrole metabolism in Arabidopsis thaliana. The Arabidopsis Book 9:e0145
  4. Waters MT, Wang P, Korkaric M, Capper RG, Saunders NJ, Langdale JA (2009) GLK transcription factors coordinate expression of the photosynthetic apparatus in Arabidopsis. Plant Cell 21:1109–1128
  5. Gisk B, Yasui Y, Kohchi T, Frankenberg-Dinkel N (2010) Characterization of the haem oxygenase protein family in Arabidopsis thaliana reveals a diversity of functions. Biochem J 425:425–434
  6. Adhikari ND, Froehlich JE, Strand DD, Buck SM, Kramer DM, Larkin RM (2011) GUN4-porphyrin complexes bind the ChlH/GUN5 subunit of Mg-Chelatase and promote chlorophyll biosynthesis in Arabidopsis. Plant Cell 23:1449–1467
  7. Gelly JC, Joseph AP, Srinivasan N, De Brevern AG (2011) iPBA: a tool for protein structure comparison using sequence alignment strategies. Nucleic Acids Res 39:18–23
  8. 8.0 8.1 Matera KM, Zhou H, Migita CT, Hobert SE, Ishikawa K, Katakura K, Maeshima H, Yoshida T, Ikeda-Saito M (1997) Histidine-132 does not stabilize a distal water ligand and is not an important residue for the enzyme activity in heme oxygenase-1. Biochemistry 36:4909–4915

Structured Information

Gene Name

Os03g0395000

Description

Similar to Heme oxygenase 2 (Fragment)

Version

NM_001056825.1 GI:115453378 GeneID:4333033

Length

3360 bp

Definition

Oryza sativa Japonica Group Os03g0395000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:16475031..16478390

Sequence Coding Region

16475569..16475661,16475774..16475881,16476725..16476948,16477781..16478348

Expression

GEO Profiles:Os03g0395000

Genome Context

<gbrowseImage1> name=NC_008396:16475031..16478390 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:16475031..16478390 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccgctcgccgccgccgtcgccgcctcggcggtcgtgccgccgcggccgcctcctccgccgccgcggagagcgcggcccttgcgctcctttactggactaatactaacgagggacctagcagccctaacggtggcccgctgcgctccctcccctcctgcccccgcggcggaggcggaggcggaggcggtggcggtggatgaggcgccgccagcgaagccgcggccgcggcggtacccgaggcagtaccccggcgaggcggtgggcgtcgccgaggagatgcggttcgtcgccatgcgcctccggaaccccaagcggaccaccctcaagatggacgatacgggggccgaggaggaggtgggcgatggcgtcagtgaggatgcgtcggcgtcagaggaggaggaggaggaggaggacgacgacgacgtggttgaggaggaggaggagggagcggggttggagggggagtggatgccgagcatggaggggttcgtcaagtacctggtggacagcaagctcgtcttcgacaccgtcgagcggatcgtagccgagtccaccgacgtcgcctatgtttacttcaggaaaagtggtctggaacgctcagctagaattacaaaagatttggagtggtttggagggcaaggaattgcagtaccagagccaagtactgctggatcaacatatgcaacttatctgactgaacttgctgagagcaatgccccagccttcctttcccactattacaatatttattttgcacatacaactggaggggtggctataggtaacaagatatccaagaaaattttggaaggaagggagctagagttttacaaatgggattctgatgtagaacttttgctaaaagataccagggagaagcttaacgaacttagcaagcattggtctcggaaggacaggaacttgtgcttgaaagaagctgcaaaatgtttccagcatttggggcggattgttcgcttaatcatcttatag</cdnaseq>

Protein Sequence

<aaseq>MPLAAAVAASAVVPPRPPPPPPRRARPLRSFTGLILTRDLAALT VARCAPSPPAPAAEAEAEAVAVDEAPPAKPRPRRYPRQYPGEAVGVAEEMRFVAMRLR NPKRTTLKMDDTGAEEEVGDGVSEDASASEEEEEEEDDDDVVEEEEEGAGLEGEWMPS MEGFVKYLVDSKLVFDTVERIVAESTDVAYVYFRKSGLERSARITKDLEWFGGQGIAV PEPSTAGSTYATYLTELAESNAPAFLSHYYNIYFAHTTGGVAIGNKISKKILEGRELE FYKWDSDVELLLKDTREKLNELSKHWSRKDRNLCLKEAAKCFQHLGRIVRLIIL</aaseq>

Gene Sequence

<dnaseqindica>2730..2822#2510..2617#1443..1666#43..610#gccgtgcaggatgcccgagtggataacccgttaaaccccccgatgccgctcgccgccgccgtcgccgcctcggcggtcgtgccgccgcggccgcctcctccgccgccgcggagagcgcggcccttgcgctcctttactggactaatactaacgagggacctagcagccctaacggtggcccgctgcgctccctcccctcctgcccccgcggcggaggcggaggcggaggcggtggcggtggatgaggcgccgccagcgaagccgcggccgcggcggtacccgaggcagtaccccggcgaggcggtgggcgtcgccgaggagatgcggttcgtcgccatgcgcctccggaaccccaagcggaccaccctcaagatggacgatacgggggccgaggaggaggtgggcgatggcgtcagtgaggatgcgtcggcgtcagaggaggaggaggaggaggaggacgacgacgacgtggttgaggaggaggaggagggagcggggttggagggggagtggatgccgagcatggaggggttcgtcaagtacctggtggacagcaagctcgtcttcgacaccgtcgagcggatcgtagccgagtccaccgacgtcgcctgtgagttgcgattcctactctccaaatccccgccttcccaatgcaattagaatatcctaattcaatgttgttccttaatcagcttagtcttcagtttccaatgcaattggaatctcctaatttttcaggaattatagatttagaatatgacatattgacttgttggtaggatggtaaaatgtgtcggtaagaacatgtttgggggatacaagctaggtggtaggaattccatttttagtgctcacttgggtatgcggcgaaggttgcaattattttggcaatatgcaaggttgaaatttaaggttgtgattattttgatggaacttgatgcatggtgtgaagtcgtggcgtgaaatgaaaattgtatggattacaattttggaaggcatttactgccaaatggtggaagatgcactttagcacaatacatgttctgcgtgtgcagcaatcatcctacggctgaatctcctttagtggtgcaccgtgaaagaaatgatcttttgggatgttctggagtatagatggcagaccatattggtaatgaagcacattgctggcatcatgcatcatagtgtacttgagcatctccgcgaagatctccgcatcgatttttgtcagtgatattgttttctgacaacttaattagtgtgagacaccaaccatgttgcctagaatgcttgccaaattgaattgttcagcactcggtagtatatgctacatacttttacgtatggctctttaggggcattcagtacctctgtttggaactttgttcaatcactgcaacagaaactgcagttacttacatatcatttatgcaattttcattcagatgtttacttcaggaaaagtggtctggaacgctcagctagaattacaaaagatttggagtggtttggagggcaaggaattgcagtaccagagccaagtactgctggatcaacatatgcaacttatctgactgaacttgctgagagcaatgccccagccttcctttcccactattacaatatttattttgcacatacaactggaggggtggctataggtaacaaggtaatgctattcccatattggatttaagtccccattaagttgtgtaatgaactgttgatatatatactcatgtttcatacctaacctgattaaatatccattatatgtctattaaactataaacaaaatataaaccagcagatttaaatgaaatactgagttcaacgctactttcttatcagatgagatgatacattgtgatttcattgtttcatgtctcaacatgtttctcattaaatggattggcagcacggagctttttgtatggagttgacaaaagagtgtaaagctgaatatctagactgatacatttctattctgggtatcagatattcatatataaagttcctctgttagctggtgatacagggctatttaaacatttggtttctattttcctttgatgtagcagcttgtggccaaaattgctaccaaatccaccaaaatatggcattgccaaagtttagtgatggatttgcgaatcaacattttggctagacattgacatccattggctccaaccaaacagccttataatagcaaagaatcttcttaaacaagaatagagagatagttgctttgttctccccatctcttttgtgattttgagctcacctgcatgccctcttaacctttttgagcgaaatacaagttctgtttaagctttcatatttcccctaaattctcttcacacttgcaccatcataataatgatgctagataatttgttcagtataaaggcaagtttactttgtagtttgtattattacaactctgtaagttctttgaaaacaaaatttatttaattgctctctgaagaagtattagtttgaaacgtaacagatatccaagaaaattttggaaggaagggagctagagttttacaaatgggattctgatgtagaacttttgctaaaagataccagggagaagcttaacgaacttagcaaggtaaccgcctcaagatcactttcttttattttcttgtaagctcgaaactggaatttgccacagaagttatatgcttatgtaacctgattagtctatctgtcatgctgtccagcattggtctcggaaggacaggaacttgtgcttgaaagaagctgcaaaatgtttccagcatttggggcggattgttcgcttaatcatcttatagttcctcatagatgagcaactgatcaaatcaacctataatctattcctgaagacaggaaagctagagatatattaaacttgaggcttagtgcagtcatttttgtcgaagactacacgtcttaactatgttgaagtctggtacagaaggatcttctggtgtgagactgaagctgatcagcgagcactatcctggagattgaaaacaccaggccacaacaatagcctcttttctggcttgcatggtggagctgctcgttggagtgagctcttgctttcagcaacttcgaactgtgcaaagttgaagatgcttgctgctgtcgatcaggatctcacgcgttcaatcgcaatgatgccagcctgacacaattcacttagcagcagaacaccatgctagccagccaggatccccccatgcctgccaaagcttcgtctcctcttgtacctcaccacattatccatttatccttgcaatgaattcgctttgcttgtaccaatcctagctactactactactaccatcttacattatccttgcaatc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0395000, RefSeq:Os03g0395000