Difference between revisions of "Os12g0583700"
(→Function) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ''Agarwal et al.'' identified a total of 189 C2H2-type zinc finger proteins in the indica rice genome and found 26 genes that were upregulated by cold, drought or salt stress <ref name="ref3"><ref name="ref4">. By gene expression analysis, ''Xu et al.'' identified several stress-related C2H2-type zinc finger proteins, such as ''ZFP182'', ''ZFP252'' and ''ZFP245'', in ''japonica'' rice. | |
| + | Using gain- and loss-of-function strategies, ''Xu et al.'' found that overexpression of ''ZFP252'' in rice increased tolerance to salt and drought stresses. The contents of free proline and soluble sugars in sense-ZFP252 transgenic rice plants were higher than those in the WT (wild-type) and antisense-''ZFP252'' transgenic rice plants under salt and drought stress. ''ZFP252'' might play a key role in stress-responsive signal transduction pathway, and be useful in engineering crop plants with enhanced tolerance to salinity and drought stresses<ref name="ref1">. | ||
===Mutation=== | ===Mutation=== | ||
Revision as of 13:25, 28 December 2014
ZFP252 is a salt and drought stress responsive TFIIIA-type zinc finger protein gene in rice[1][2].
Contents
Annotated Information
Function
Agarwal et al. identified a total of 189 C2H2-type zinc finger proteins in the indica rice genome and found 26 genes that were upregulated by cold, drought or salt stress <ref name="ref3"><ref name="ref4">. By gene expression analysis, Xu et al. identified several stress-related C2H2-type zinc finger proteins, such as ZFP182, ZFP252 and ZFP245, in japonica rice. Using gain- and loss-of-function strategies, Xu et al. found that overexpression of ZFP252 in rice increased tolerance to salt and drought stresses. The contents of free proline and soluble sugars in sense-ZFP252 transgenic rice plants were higher than those in the WT (wild-type) and antisense-ZFP252 transgenic rice plants under salt and drought stress. ZFP252 might play a key role in stress-responsive signal transduction pathway, and be useful in engineering crop plants with enhanced tolerance to salinity and drought stresses<ref name="ref1">.
Mutation
Expression
Evolution
Knowledge Extension
Labs working on this gene
References
Structured Information
| Gene Name |
Os12g0583700 |
|---|---|
| Description |
Zinc finger, C2H2-type domain containing protein |
| Version |
NM_001073680.1 GI:115489321 GeneID:4352653 |
| Length |
1004 bp |
| Definition |
Oryza sativa Japonica Group Os12g0583700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 12:24441085..24442088 |
| Sequence Coding Region |
24441233..24441976 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008405:24441085..24442088 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008405:24441085..24442088 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggtggaggcggttcttgaggcgtcgagaagtagtagtgaggaggaggcggaggtgatcgtcacgcacggcggcggcggcggcggcggaggaggaggaggacaggtggaggggtgggggaagcggaagcggtcgcggcggcggcgaccgcagctgccgccctccgaggaggagtacctcgcgctctgcctcctcatgctggcgcgcgggcgacgcgacggcgacgacgtggcggcgtcggcgtcggcggcggcggcggcggtggagcaccggtgctccgtctgcggcaaggcgttcgcgtcctaccaggctctcggcggccacaaggccagccaccggaagccgccgccgcccgccatggtcgacgacgacgaggtggtggtggagacgaaaccggcggctatcgcgacgccgtcctcgtcggcgtcgggcgtctccggcggcggcggcgggagggcgcacgagtgcaacgtgtgcggcaaggcgttcccgacggggcaggcgctgggcggccacaagcgatgccactacgacggcacgatcggcagcgccgccggcgccggcgcgtccaagccggcggcgaagacgaccgtggcggtggcggcgagccggggcttcgacctcaacctgccggcgctgccggacgtcgccgccgccgccgaccagcggtgcgcggcggaggacgacgaggtgctcagccctctcgccttcaagaagcccaggctcatgatcccggcatag</cdnaseq> |
| Protein Sequence |
<aaseq>MAVEAVLEASRSSSEEEAEVIVTHGGGGGGGGGGGQVEGWGKRK RSRRRRPQLPPSEEEYLALCLLMLARGRRDGDDVAASASAAAAAVEHRCSVCGKAFAS YQALGGHKASHRKPPPPAMVDDDEVVVETKPAAIATPSSSASGVSGGGGGRAHECNVC GKAFPTGQALGGHKRCHYDGTIGSAAGAGASKPAAKTTVAVAASRGFDLNLPALPDVA AAADQRCAAEDDEVLSPLAFKKPRLMIPA</aaseq> |
| Gene Sequence |
<dnaseqindica>113..856#tctccttccatttttcttgtgcacttctctttcccttgcaagctcaagaaacccaattaattaagatagttgtgatcatctccaagcttagctaattaagctactagtggccatggcggtggaggcggttcttgaggcgtcgagaagtagtagtgaggaggaggcggaggtgatcgtcacgcacggcggcggcggcggcggcggaggaggaggaggacaggtggaggggtgggggaagcggaagcggtcgcggcggcggcgaccgcagctgccgccctccgaggaggagtacctcgcgctctgcctcctcatgctggcgcgcgggcgacgcgacggcgacgacgtggcggcgtcggcgtcggcggcggcggcggcggtggagcaccggtgctccgtctgcggcaaggcgttcgcgtcctaccaggctctcggcggccacaaggccagccaccggaagccgccgccgcccgccatggtcgacgacgacgaggtggtggtggagacgaaaccggcggctatcgcgacgccgtcctcgtcggcgtcgggcgtctccggcggcggcggcgggagggcgcacgagtgcaacgtgtgcggcaaggcgttcccgacggggcaggcgctgggcggccacaagcgatgccactacgacggcacgatcggcagcgccgccggcgccggcgcgtccaagccggcggcgaagacgaccgtggcggtggcggcgagccggggcttcgacctcaacctgccggcgctgccggacgtcgccgccgccgccgaccagcggtgcgcggcggaggacgacgaggtgctcagccctctcgccttcaagaagcccaggctcatgatcccggcatagctagccaagcccacaagatttgtttaattttagccataaaattccattaaattaaacccatagttttttctgttaattactttcttaatttggtgattagtcttaggaatgatgattagtttgtgtatatagccattgtttgttcatc</dnaseqindica> |
| External Link(s) |
