Difference between revisions of "Os07g0186000"
(→Function) |
|||
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ''OsTRXh1'' could be secreted into the rice apoplast by transient expression and immunohistochemistry experiments. Furthermore, in | |
| + | the apoplast of rice, ''OsTRXh1'' was induced by salt stress at the protein level. It has a conserved redox-active site (WCGPC), which involves in the redox status regulation of target proteins. ''OsTRXh1'' not only had the ability to reduce insulin in the presence of DTT but also it can complement the hydrogen peroxide sensitivity of the thioredoxin-deficient yeast mutant. ''OsTRXh1'' possesses disulfide reductase activity and could be secreted into the extracellular regions. The knockdown and overexpression transgenic plants in rice showed that it involved in salt and ABA response regulation. More hydrogen peroxide was produced in the extracellular space of ''OsTRXh1'' knockdown plants than in wild-type plants under salt stress, whereas the OsTRXh1 overexpression plants produced less hydrogen peroxide under the same conditions,which suggesting that ''OsTRXh1'' regulated apoplastic ROS accumulation and influenced plant stress responses in rice<ref name="ref1"/><ref name="ref2"/>. | ||
| + | Recently, a report showed that ''OsTRXh1'' was induced by cold stress and negatively regulated the kinase activities of ''Oryza sativa'' Mitogen-activated Protein Kinase3 (''OsMPK3'') and ''OsMPK6'' in vitro through a redox-dependent mechanism<ref name="ref3"/>. | ||
| + | |||
| + | '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0005489 GO:0005489], [http://amigo.geneontology.org/amigo/term/GO:0006118 GO:0006118] | ||
===Mutation=== | ===Mutation=== | ||
Revision as of 10:38, 2 January 2015
As a subgroup I h-type Trx in rice, OsTRXh1 regulates the redox state of the apoplast and influences plant development and stress responses[1][2].
Contents
Annotated Information
Function
OsTRXh1 could be secreted into the rice apoplast by transient expression and immunohistochemistry experiments. Furthermore, in the apoplast of rice, OsTRXh1 was induced by salt stress at the protein level. It has a conserved redox-active site (WCGPC), which involves in the redox status regulation of target proteins. OsTRXh1 not only had the ability to reduce insulin in the presence of DTT but also it can complement the hydrogen peroxide sensitivity of the thioredoxin-deficient yeast mutant. OsTRXh1 possesses disulfide reductase activity and could be secreted into the extracellular regions. The knockdown and overexpression transgenic plants in rice showed that it involved in salt and ABA response regulation. More hydrogen peroxide was produced in the extracellular space of OsTRXh1 knockdown plants than in wild-type plants under salt stress, whereas the OsTRXh1 overexpression plants produced less hydrogen peroxide under the same conditions,which suggesting that OsTRXh1 regulated apoplastic ROS accumulation and influenced plant stress responses in rice[1][2]. Recently, a report showed that OsTRXh1 was induced by cold stress and negatively regulated the kinase activities of Oryza sativa Mitogen-activated Protein Kinase3 (OsMPK3) and OsMPK6 in vitro through a redox-dependent mechanism[3].
GO assignment(s): GO:0005489, GO:0006118
Mutation
Expression
Please input expression information here.
Subcellular localization
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
knowledge extension
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os07g0186000 |
|---|---|
| Description |
Similar to Thioredoxin h isoform 1 |
| Version |
NM_001065604.1 GI:115470940 GeneID:4342593 |
| Length |
1911 bp |
| Definition |
Oryza sativa Japonica Group Os07g0186000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:4606471..4608381 |
| Sequence Coding Region |
4606739..4606894,4606976..4607098,4608199..4608288 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:4606471..4608381 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:4606471..4608381 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccgccgaggagggagtcgtgatcgcctgccacaacaaggacgagttcgacgcccagatgaccaaggccaaggaggccggcaaagtggtcataattgacttcactgcttcctggtgtggcccttgccgcttcatcgccccagtgttcgctgaatacgccaaaaagttccctggtgctgtcttcctgaaggttgatgttgatgagctgaaggaagttgctgaaaagtacaatgtcgaggcaatgccgaccttcctattcatcaaggatggtgctgaggctgacaaggtcgttggcgccaggaaggatgacctccagaacaccatcgtgaagcacgtcggtgccactgctgcatctgcttctgcctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MAAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCR FIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARK DDLQNTIVKHVGATAASASA</aaseq> |
| Gene Sequence |
<dnaseqindica>1488..1643#1284..1406#94..183#gcaatctcatcgcaagaaaagaaaaaaaatcctattcaaatcgaaacccctctctttgatctcgtcgccgaggaattaggaggagagagagcaatggccgccgaggagggagtcgtgatcgcctgccacaacaaggacgagttcgacgcccagatgaccaaggccaaggaggccggcaaagtggtaagtttcctggcgcagaattttggggatttttttttgggggttttgttcaccagggggtcgcggttcgtcttagatcgataggattttgaagaaatttaggatttaatttcttgctgagatttgtggcatgtggtgaaatcgcgaggagatcgattgtttctattttggcgattggggcgtagggttgtcgcggatttggggattgccgattctggtgggggagattttagtagtagattttcatgaatatattttaggatgatataatgaacaattcttttaaaagaaatctgttgcagtaattacagggcactctgtatttgacatgattaatcgttgatgtttggattttaccatgagatggggcgatttgatgcttacatctgcaagcgaattttcatccgctatctgtatagtatttgactccataggcgaaattgttagtgtttaaatttaccgtaagatgggatggtgtgatgtgatgtttaggtttgctccagttgtttcatgctgatgattctctaatttgagtataagctttgtttaaatatatagatatattcttaaatagtactataatttgacatgattcgccagagttgaaggaaatctggttctaatctagttcaattgttgttatggacaatagattgccacttcacatgtcttggcattgttatgatgtgatgctttgtacagataagcgtccgccctgtagtattggatttggtttcttgctgcgcggcataaacgaggattttgaccaagagtattatatttgaactgtattagatttggtttcttgctgtgcggcatcaacgaggattttgatcaagagtagttagcacttaccaggctgatatattgttgtctatggaattatcaatggttcttggatttattttctttctgtgcaacaacaacaaggttgccaaagaatatttatctagtatgaaattctgaactagtggtacttatgcttgtcatgccaataactgtgaggctaccgttattctttcttactgcgcaattgaccatttgttcatgtcatgtttccatccctaatgatggccttttctggactgtttgatctacaggtcataattgacttcactgcttcctggtgtggcccttgccgcttcatcgccccagtgttcgctgaatacgccaaaaagttccctggtgctgtcttcctgaaggttgatgttgatgagctgaaggtgcgcagagttgcccacaatcttccaaaaacatttttgtcacccctgtgatagtgagtaatgcttttctttatccaacaggaagttgctgaaaagtacaatgtcgaggcaatgccgaccttcctattcatcaaggatggtgctgaggctgacaaggtcgttggcgccaggaaggatgacctccagaacaccatcgtgaagcacgtcggtgccactgctgcatctgcttctgcctaagaattctcgcaggcgcaagttatcaaataagggccagcacctggtgttgtagtaggtattagcgttagtcatcgttatcgtcagtttggcttgggtgtcctcgaatatcatgcgaaatcgattccgagttctctttttaaaattcctgatgatgatatatagtttgtggaaatttggatctggctattctgtacgagtttgctgactattaaagcaattattataatatgatgatgctggcaagcttgtagatagcttgaatttgtcc</dnaseqindica> |
| External Link(s) |
