Difference between revisions of "Os07g0666900"

From RiceWiki
Jump to: navigation, search
(Function)
(Mutation)
Line 20: Line 20:
  
 
===Mutation===
 
===Mutation===
 +
[[File: OsNHX1-OE transgenic.jpg|right|thumb|300px|'''Figure 1.''''' RT-PCR of OsNHX1-OE transgenic plants.(from reference <ref name="ref1"/>).'']]
 +
1. Overexpression lines of ''OsNHX1''<ref name="ref1"/>:
 +
*T4
 +
*T5
 +
*T6
  
 +
2. Transgenic lines:''OsNHX1''-OE<ref name="ref1"/>.
 +
 +
3. OsNHX1-143 transgenic rice VS. wild-type:<ref name="ref3"/><br>
 +
*By using Agrobacterium- mediated transformation three independent T0 transgenic lines were produced from which Actin 1DOsNHX1-143 was found to be the most prominent event after molecular and stress tolerance analysis.
 +
 +
*The increased accumulation of Na+ in transgenic lines through the over-expression of ''OsNHX1''. The increased accumulation of Na<sup>+</sup>‡ion in the vacuoles may be responsible for alleviating the toxic effects of excessive Na<sup>+</sup> ion in the cytosol.
 +
 +
*In the case of variety, the transgenic line showed significantly higher spikelet number and yield compared to the wild-type. In the case of Variety x Treatment, only spikelet number was found to be significantly higher in transgenic plants compared to the wild-type
 +
 +
4. ''ena1-4△'' ''nha1△'' ''nhx1△''<ref name="ref4"/>:<br> 
 +
A triple mutant strain of Saccharomyces cerevisiae lacking its own Na+-ATPases and Na+/H+ antiporters (''ena1-4△'' ''nha1△'' ''nhx1△'') was used for the expression of the Oryza sativa NHX1 gene encoding a putative vacuolar Na+/H+ exchanger.
 +
 +
5. Yeast ''nhx1'' mutants lines<ref name="ref5"/>:
 +
*''osnhx1-1''
 +
*''osnhx1-2''<br>
 +
''nhx1'' mutants were sensitive to a high K<sup>+</sup> concentration in APG medium.
 +
 +
6. transgenic cell lines<ref name="ref5"/>:
 +
*95-1-35
 +
*95-5-169
  
 
===Expression===
 
===Expression===

Revision as of 16:05, 9 January 2015

OsNHX1(Os07g0666900), is a Na+ and H+ exchanger in rice (Oryza sativa)[1][2][3][4][5][6][7].

Annotated Information

Function

  • OsNHX1, functions as a Na+‡and H+‡exchanger and plays important roles in salt tolerance of rice[1][2][3][4][5][6]. OsNHX1 may play an important role in the salt tolerance of shoots rather than roots[5].
  • Na+/H+‡exchanger catalyzes the countertransport of Na+‡and H+‡across membranes. Fukuda et al isolated a rice cDNA clone the deduced amino acid sequence of which had homology with a putative Na+/H+‡exchanger in Saccharomyces cerevisiae, NHX1. The sequence contains 2330 bp with an open reading frame of 1608 bp[2].
  • OsNHX1 plays important roles in the compartment of Na+ from the cytoplasm of cells into the vacuoles in both of the tissues[2][5].
  • Expression of OsNHX1 under the constitutive promoter Actin1D can confer enhanced salinity tolerance in transgenic rice plants. It also function towards alleviation of toxic effects of salt stress at all stages of the life cycle from seedling to maturity[3].
  • OsNHX1 has the ability to suppress Na+, Li+ and hygromycin sensitivity of yeast nhx1 mutants and sensitivity to a high K+ concentration, a novel phenotype of the nhx1 mutants[5].
  • The expression of OsNHX1, OsNHX2, OsNHX3, and OsNHX5 is regulated differently in rice tissues and is increased by salt stress, hyperosmotic stress, and ABA[6].
  • OsNHX expression was also enhanced under submergence, and the levels of OsNHX1 and OsNHX5 transcripts agreed well with those of seedling vigor under submergence[7].


GO assignment(s): GO:0006814, GO:0006885, GO:0015299, GO:0015385, GO:0016021

Mutation

Figure 1. RT-PCR of OsNHX1-OE transgenic plants.(from reference [1]).

1. Overexpression lines of OsNHX1[1]:

  • T4
  • T5
  • T6

2. Transgenic lines:OsNHX1-OE[1].

3. OsNHX1-143 transgenic rice VS. wild-type:[3]

  • By using Agrobacterium- mediated transformation three independent T0 transgenic lines were produced from which Actin 1DOsNHX1-143 was found to be the most prominent event after molecular and stress tolerance analysis.
  • The increased accumulation of Na+ in transgenic lines through the over-expression of OsNHX1. The increased accumulation of Na+‡ion in the vacuoles may be responsible for alleviating the toxic effects of excessive Na+ ion in the cytosol.
  • In the case of variety, the transgenic line showed significantly higher spikelet number and yield compared to the wild-type. In the case of Variety x Treatment, only spikelet number was found to be significantly higher in transgenic plants compared to the wild-type

4. ena1-4△ nha1△ nhx1△[4]:
A triple mutant strain of Saccharomyces cerevisiae lacking its own Na+-ATPases and Na+/H+ antiporters (ena1-4△ nha1△ nhx1△) was used for the expression of the Oryza sativa NHX1 gene encoding a putative vacuolar Na+/H+ exchanger.

5. Yeast nhx1 mutants lines[5]:

  • osnhx1-1
  • osnhx1-2

nhx1 mutants were sensitive to a high K+ concentration in APG medium.

6. transgenic cell lines[5]:

  • 95-1-35
  • 95-5-169

Expression

Please input expression information here.

Location

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Knowledge Extension

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0666900

Description

Similar to Na+/H+ antiporter NHX6

Version

NM_001067106.1 GI:115473944 GeneID:4344217

Length

4884 bp

Definition

Oryza sativa Japonica Group Os07g0666900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:28824582..28829465

Sequence Coding Region

28824892..28825065,28825168..28825286,28826171..28826268,28826391..28826450,28826549..28826595
,28826676..28826870,28826973..28827019,28827100..28827166,28827258..28827358
,28827462..28827563,28827641..28827779,28827857..28827919,28828060..28828143
,28828718..28829032

Expression

GEO Profiles:Os07g0666900

Genome Context

<gbrowseImage1> name=NC_008400:28824582..28829465 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:28824582..28829465 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ggcatggggatggaggtggcggcggcgcggctgggggctctgtacacgacctccgactacgcgtcggtggtgtccatcaacctgttcgtcgcgctgctctgcgcctgcatcgtcctcggccacctcctcgaggagaatcgctgggtcaatgagtccatcaccgcgctcatcatcgggctctgcaccggcgtggtgatcttgctgatgaccaaagggaagagctcgcacttattcgtcttcagtgaggatctcttcttcatctacctcctccctccgatcatcttcaatgcaggttttcaggtaaagaaaaagcaattcttccggaatttcatgacgatcacattatttggagccgtcgggacaatgatatcctttttcacaatatctattgctgccattgcaatattcagcagaatgaacattggaacgctggatgtaggagattttcttgcaattggagccatcttttctgcgacagattctgtctgcacattgcaggtcctcaatcaggatgagacaccctttttgtacagtctggtattcggtgaaggtgttgtgaacgatgctacatcaattgtgcttttcaacgcactacagaactttgatcttgtccacatagatgcggctgtcgttctgaaattcttggggaacttcttttatttatttttgtcgagcaccttccttggagtatttgctggattgctcagtgcatacataatcaagaagctatacattggaaggcattctactgaccgtgaggttgcccttatgatgctcatggcttacctttcatatatgctggctgagttgctagatttgagcggcattctcaccgtattcttctgtggtattgtaatgtcacattacacttggcataacgtcacagagagttcaagagttacaacaaagcacgcatttgcaactctgtccttcattgctgagacttttctcttcctgtatgttgggatggatgcattggatattgaaaaatgggagtttgccagtgacagacctggcaaatccattgggataagctcaattttgctaggattggttctgattggaagagctgcttttgtattcccgctgtcgttcttgtcgaacctaacaaagaaggcaccgaatgaaaaaataacctggagacagcaagttgtaatatggtgggctgggctgatgagaggagctgtgtcgattgctcttgcttacaataagtttacaagatctggccatactcagctgcacggcaatgcaataatgatcaccagcaccatcactgtcgttctttttagcactatggtatttgggatgatgacaaagccattgatcaggctgctgctaccggcctcaggccatcctgtcacctctgagccttcatcaccaaagtccctgcattctcctctcctgacaagcatgcaaggttctgacctcgagagtacaaccaacattgtgaggccttccagcctccggatgctcctcaccaagccgacccacactgtccactactactggcgcaagttcgacgacgcgctgatgcgaccgatgtttggcgggcgcgggttcgtgcccttctcccctggatcaccaaccgagcagagccatggaggaagatga</cdnaseq>

Protein Sequence

<aaseq>GMGMEVAAARLGALYTTSDYASVVSINLFVALLCACIVLGHLLE ENRWVNESITALIIGLCTGVVILLMTKGKSSHLFVFSEDLFFIYLLPPIIFNAGFQVK KKQFFRNFMTITLFGAVGTMISFFTISIAAIAIFSRMNIGTLDVGDFLAIGAIFSATD SVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFNALQNFDLVHIDAAVVLKFLGNF FYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVALMMLMAYLSYMLAELLDLSGI LTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFLFLYVGMDALDIEKWEFA SDRPGKSIGISSILLGLVLIGRAAFVFPLSFLSNLTKKAPNEKITWRQQVVIWWAGLM RGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGMMTKPLIRLLLPASG HPVTSEPSSPKSLHSPLLTSMQGSDLESTTNIVRPSSLRMLLTKPTHTVHYYWRKFDD ALMRPMFGGRGFVPFSPGSPTEQSHGGR</aaseq>

Gene Sequence

<dnaseqindica>311..484#587..705#1590..1687#1810..1869#1968..2014#2095..2289#2392..2438#2519..2585#2677..2777#2881..2982#3060..3198#3276..3338#3479..3562#4137..4451#acgaaaagagagagagagagaagagagttttgtagcgagctcgcgcgaatgcgaagccaaccgagagaggtctcgataccaaatcccgatttctcaacctgaatcccccccccacgttcctcgtttcaatctgttcgtctgcgaatcgaattctttgtttttttttctctaattttaccgggaattgtcgaattaggcattcaccaacgagcaagaggggagtggattggttggttaaagctccgcatcttgcggcggaaatctcgctctcttctctgcggtgggtggccggagaagtcgccgccggtgaggcatggggatggaggtggcggcggcgcggctgggggctctgtacacgacctccgactacgcgtcggtggtgtccatcaacctgttcgtcgcgctgctctgcgcctgcatcgtcctcggccacctcctcgaggagaatcgctgggtcaatgagtccatcaccgcgctcatcatcgtaagcgcacacacaccattgctgtgattgattgatcgattgattcgccattgttgctgacgcacgcttgctgctcgatgatttgcttgcttgcttgggcaggggctctgcaccggcgtggtgatcttgctgatgaccaaagggaagagctcgcacttattcgtcttcagtgaggatctcttcttcatctacctcctccctccgatcatcttcaatgcagggtaagtagaaacgcttcggcgtgttcttgctgtggttagatttcggcttcagttcttttgttggcacatggtggtgtacaaggtttttctggggattggggaatctgtttgctgctggtggtacactgtgtacgcgtggctggtttcttgtttgtttcttctgggcctagctgtctgtccgtcgatgtcttagacatggctgctagttcatactgtgcaggttgtgggtgaattttttttttgttttctctttaagacagagatggatttactctcgtcttactggcataccttgacttgccagctcgaactgctgattggtacagtatggagtagcaactgtaatcttgaccattgcatgaagcattgagaaatgctgaaagattatttgttttttaattttaattattatatattgattgactgtgcaacagcttctgtctcctagagttctactcttggtccatttacagtggttagtagtactggtcatccaacaccatgaaggcatgagagggatatggtcctgtcaagagtgatggcgtgatcaatttctgaaagaacagtggccatgctagtccgaatttggttgagcatttaatccccttttgaaggtttttgggccatccatatagatttgaagtagggttgtaggagtaaagctgaatattatgggcccatgtttgctttcacatttaggaattgcaaagtctctctttgggaaagggcacaagtcctttttgagttcagagttactctattttcgttccttttctgctttgcttgaacttttattttttttattcatataataacacaagttgctgaataattctacgggaaaaaaagcatcgtcctggtcctcacaaatatttttccatcagttttcaggtaaagaaaaagcaattcttccggaatttcatgacgatcacattatttggagccgtcgggacaatgatatcctttttcacaatatctattggtacgttctttcagaaatgattcttaattcttccgtgagttggtagtgctttcattttctgttgttccgtgtaaccttttggacttctgagattctgactctgatcaatttcttaatttcagctgccattgcaatattcagcagaatgaacattggaacgctggatgtaggagattttcttggtaagccatggctatctttctgcatgatcatgctggcactaatattgacaccatgtgagcatcatttcctcctgttgactgttatgttcaatgtgcagcaattggagccatcttttctgcgacagattctgtctgcacattgcaggttagttgaacaaattttgccatacctcgagagagacctggattcaacgtgctaatgtaatgatcttaaccccaaaacaggtcctcaatcaggatgagacaccctttttgtacagtctggtattcggtgaaggtgttgtgaacgatgctacatcaattgtgcttttcaacgcactacagaactttgatcttgtccacatagatgcggctgtcgttctgaaattcttggggaacttcttttatttatttttgtcgagcaccttccttggagtatttgtaagttgattcttaagtttcactttttacatcttactgtctgtcttgactctactgcttggttgacacatgtaaacttaatattcttcttccaccctgcaggctggattgctcagtgcatacataatcaagaagctatacattggaaggttagttaagcccaaacaaaccctcattagttaacggttttatgctcagtgttaacttggatgttggtgactgattccaggcattctactgaccgtgaggttgcccttatgatgctcatggcttacctttcatatatgctggctgaggtgtgcctctgctttgatgcagtatcaaaatttgcatatagtttcattttatagtttgattttatctactttgtttgtttgatattggcagttgctagatttgagcggcattctcaccgtattcttctgtggtattgtaatgtcacattacacttggcataacgtcacagagagttcaagagttacaacaaagtaaattataattctcattccatattctactgtttaatgattagcttcagttcgtagaaaaactaaacaaaacttactggtttgttttgtcctttcacctcaggcacgcatttgcaactctgtccttcattgctgagacttttctcttcctgtatgttgggatggatgcattggatattgaaaaatgggagtttgccagtgacaggtctgatacatgttctcatacctaattcctatttatggatatggagactcaattttacttctctttcccattcgcagacctggcaaatccattgggataagctcaattttgctaggattggttctgattggaagagctgcttttgtattcccgctgtcgttcttgtcgaacctaacaaagaaggcaccgaatgaaaaaataacctggagacagcaagtgagtatctggtgtatgatcagacaattttcatttgaattcgacttgccatctgctaactgaatttctctcgataggttgtaatatggtgggctgggctgatgagaggagctgtgtcgattgctcttgcttacaataaggtcagtccgtcagtgcaagactattgcttcacaccatctgtatatctgtatttctcttctcatcttgccattaattagtcccaggagaagtatgtcttagtttcttctccttaagcttaactgtctcgttgcaattgcagtttacaagatctggccatactcagctgcacggcaatgcaataatgatcaccagcaccatcactgtcgttctttttagcactatggtgagtcatcttactgcaacctatgcctaacgcaaagcgtcctcttttcatccaagtttgtgccacatgtctgaattctcaccctaaacaggacctcagcattaagctaacctaataataagttcctcaaagtcgattgtcaaatcaaaattgtcagctgtgacaaaagtaatctggaagcttgtaatgttgaacatgctctaatccaaccaaaaccaactactgaccggagaatgaaatcatgtctttttgtccctactatcttgtcctcttcttatcccttctgaagagattgccgtaccgtccagtcattgactcatcgtccatattctcacatgacatggatcaaggatggcacaattatttgaaattaattgtcgtttgttactactagcttttcgttttagttttctggatgtttctttaggaagacatacatgtgtcatcatgtcgaattgcgcatccaatcacttgattgtttacgagctaaatccttgttcagaatccctggaagctcaaatgtgcaaaacatctatttttgtgaaacatactgacatttataaatgtttattaggtatttgggatgatgacaaagccattgatcaggctgctgctaccggcctcaggccatcctgtcacctctgagccttcatcaccaaagtccctgcattctcctctcctgacaagcatgcaaggttctgacctcgagagtacaaccaacattgtgaggccttccagcctccggatgctcctcaccaagccgacccacactgtccactactactggcgcaagttcgacgacgcgctgatgcgaccgatgtttggcgggcgcgggttcgtgcccttctcccctggatcaccaaccgagcagagccatggaggaagatgaacagtgcaaagaaatgagaatggaatggttgatgaggagaatacatgtaaaatgtgacagcaaaagagagaaggcaagttttgggtttgtagagtttggctgctgctaatgagttgttgatagtgcctatattcttcagaacttcagatggtgcctcaccaaggcctaagagccaggaggaccttctgataatggttcgggatgattggtttgttctgtcaggatgaaccctagtgagtgacacagggtgatgtgctccgacaacctgtaaattttgtagattaacagccccatttgtacctgtctaccatctttagttggcgggtgttctttcctagttgccaccctgcatgtaaaatgaaattctccgccaaaatagatttgtgtgtataataattttgcttggttgatataatggtatggcatggtttgc</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0666900, RefSeq:Os07g0666900

  1. 1.0 1.1 1.2 1.3 1.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 3.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 4.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. 5.0 5.1 5.2 5.3 5.4 5.5 5.6 Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. 6.0 6.1 6.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  7. 7.0 7.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref7