Difference between revisions of "Os07g0556800"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
Please input one-sentence summary here.
+
''Oryza sativa Ribosome-inactivating protein gene 18 (OSRIP18)'' may be potentially useful in further improving plant tolerance to various abiotic stresses by over-expression<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Please input function information here.
+
*''OSRIP18(Os07g0556800)'' might play a role in increasing tolerance to drought and high salinity during panicle development but not in seedling stage. After overexpression, active expression can be detected in all tested developmental stages and as a result, the transgenic plants exhibited higher tolerance to both stresses in these stages<ref name="ref1"/>. It means the gene may play a role as a member of natural defense system against various environmental conditions including drought and high salinity stresses<ref name="ref2"/>.
 +
 
 +
*''OSRIP18'' may play a role in pollen development by sensing different environmental cues, the gene may play important roles as a member of natural defense system against varying environmental conditions during pollen development<ref name="ref2"/>.
 +
 
 +
*''OSRIP18'' and other rice RIP genes may be potentially useful for developing new plant varieties with higher tolerance to various stresses<ref name="ref2"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0017148 GO:0017148], [http://amigo.geneontology.org/amigo/term/GO:0030598 GO:0030598]
 +
 
 +
===Mutation===
 +
transgenic lines<ref name="ref1"/>:
 +
*UT66
 +
*UT71
 +
*UT3
 +
*UT64
 +
To investigate the biological functions of the ''OSRIP18'' gene, it was ectopically expressed under the control of 35S promoter. Totally, 33 transgenic plants were generated with this construct. These plants were integrated 1–4 copies of the construct by southern blot analysis. Among them, '''11''' independent transgenic plants contained single copy insertion of the T-DNA and they were used for further investigation. All of them showed significantly increased tolerance to drought and high salinity stresses.  
  
 
===Expression===
 
===Expression===
Line 12: Line 26:
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 +
 +
 +
===Knowledge Extension===
 +
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*Rice Functional Genomics Group, Temasek Life Sciences Laboratory, 1 Research Link, The National University of Singapore, Singapore 117604, Singapore
 +
*Republic Polytechnic, 9 Woodlands Ave 9, Singapore 738964, Singapore
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Jiang S Y, Bhalla R, Ramamoorthy R, et al. Over-expression of OSRIP18 increases drought and salt tolerance in transgenic rice plants[J]. Transgenic research, 2012, 21(4): 785-795.
 +
</ref>
 +
* <ref name="ref2">
 +
Jiang S Y, Ramamoorthy R, Bhalla R, et al. Genome-wide survey of the RIP domain family in Oryza sativa and their expression profiles under various abiotic and biotic stresses[J]. Plant molecular biology, 2008, 67(6): 603-614.
 +
</ref>
 +
* <ref name="ref3">
 +
Girbes T, Ferreras J M, Arias F J, et al. Description, distribution, activity and phylogenetic relationship of ribosome-inactivating proteins in plants, fungi and bacteria[J]. Mini reviews in medicinal chemistry, 2004, 4(5): 461-476.
 +
</ref>
 +
* <ref name="ref4">
 +
Ding Z, Wu X, Wang T. The rice tapetum-specific gene RA39 encodes a type I ribosome-inactivating protein[J]. Sexual Plant Reproduction, 2002, 15(4): 205-212.
 +
</ref>
 +
* <ref name="ref5">
 +
Stirpe F. Ribosome-inactivating proteins: From toxins to useful proteins[J]. Toxicon, 2013, 67: 12-16.
 +
</ref>
 +
* <ref name="ref6">
 +
Depuydt P. Ribosome-inactivating proteins from apple: are they really toxic?[J]. 2013.</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 08:40, 12 January 2015

Oryza sativa Ribosome-inactivating protein gene 18 (OSRIP18) may be potentially useful in further improving plant tolerance to various abiotic stresses by over-expression[1].

Annotated Information

Function

  • OSRIP18(Os07g0556800) might play a role in increasing tolerance to drought and high salinity during panicle development but not in seedling stage. After overexpression, active expression can be detected in all tested developmental stages and as a result, the transgenic plants exhibited higher tolerance to both stresses in these stages[1]. It means the gene may play a role as a member of natural defense system against various environmental conditions including drought and high salinity stresses[2].
  • OSRIP18 may play a role in pollen development by sensing different environmental cues, the gene may play important roles as a member of natural defense system against varying environmental conditions during pollen development[2].
  • OSRIP18 and other rice RIP genes may be potentially useful for developing new plant varieties with higher tolerance to various stresses[2].

GO assignment(s): GO:0017148, GO:0030598

Mutation

transgenic lines[1]:

  • UT66
  • UT71
  • UT3
  • UT64

To investigate the biological functions of the OSRIP18 gene, it was ectopically expressed under the control of 35S promoter. Totally, 33 transgenic plants were generated with this construct. These plants were integrated 1–4 copies of the construct by southern blot analysis. Among them, 11 independent transgenic plants contained single copy insertion of the T-DNA and they were used for further investigation. All of them showed significantly increased tolerance to drought and high salinity stresses.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.


Knowledge Extension

Labs working on this gene

  • Rice Functional Genomics Group, Temasek Life Sciences Laboratory, 1 Research Link, The National University of Singapore, Singapore 117604, Singapore
  • Republic Polytechnic, 9 Woodlands Ave 9, Singapore 738964, Singapore

References

  1. ↑ 1.0 1.1 1.2 Jiang S Y, Bhalla R, Ramamoorthy R, et al. Over-expression of OSRIP18 increases drought and salt tolerance in transgenic rice plants[J]. Transgenic research, 2012, 21(4): 785-795.
  2. ↑ 2.0 2.1 2.2 Jiang S Y, Ramamoorthy R, Bhalla R, et al. Genome-wide survey of the RIP domain family in Oryza sativa and their expression profiles under various abiotic and biotic stresses[J]. Plant molecular biology, 2008, 67(6): 603-614.

Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref4" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref5" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref6" defined in <references> is not used in prior text.


Structured Information

Gene Name

Os07g0556800

Description

Ribosome-inactivating protein family protein

Version

NM_001066499.1 GI:115472730 GeneID:4343572

Length

1037 bp

Definition

Oryza sativa Japonica Group Os07g0556800, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:22882458..22883494

Sequence Coding Region

22882542..22883438

Expression

GEO Profiles:Os07g0556800

Genome Context

<gbrowseImage1> name=NC_008400:22882458..22883494 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:22882458..22883494 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaa</cdnaseq>

Protein Sequence

<aaseq>MVKPAAVLLLLYLPLLATPTRIGLSRNPFVPPPNSVPTIDRTEM DVSTSPYRDLIKKWRDLVLLNTRPEVMVPEDHPVLAPQYDDTVPPERLLLPKLVANGD KTATLALRDSNIYFIGFANKAGQWFSFKDRNDLPPSFRARPLSFGVDYASIAGFRKNL PNYPLGRRQTEWAVKVLSEYDPNRTDEATIKRAVVIILLTFCEALRFFPIRNAVEIGW DSVAYITSTDADRLVCWGQISYMLEYSFMSGHSWDSEEQRTRLKNLARDCKIFNEPQA LETVDVLEYGAILGAKSTNWLY</aaseq>

Gene Sequence

<dnaseqindica>57..953#aaaaaaagcccaaaccttcaagttcacctttgcttaattgcaccagcttagccgtcatggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaatgcaaggtgtaagcgccctcctagctaatataggcgcacttccacaatttatgtactccaatattatgcaactcacatggtgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0556800, RefSeq:Os07g0556800

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0556800&oldid=184692"