Difference between revisions of "Os07g0556800"

From RiceWiki
Jump to: navigation, search
(Expression)
Line 20: Line 20:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File: OSRIP18 transgenic1.jpg|right|thumb|270px|'''Figure 1.'''''Phenotypic characterization of transgenic plants overexpressing OSRIP18.(from reference <ref name="ref1"/>).'']]
 +
*Transgenic plants overexpressing ''OSRIP18''<ref name="ref1"/>:
 +
**11 independent transgenic plants with single copy of T-DNA insertion were fertile and the seeding rates had no co-relation with ectopic expression this gene. Some of the data were shown in Fig. 1a.
 +
**After treatment for 2 h under 30% PEG solution, transgenic plants still showed normal leaf phenotype while WT plants exhibited withered and curved leaves (Fig. 1b). The result suggested that ectopic expression of this gene in rice increased its tolerance to 30% PEG stress.
 +
**The increased tolerance to drought and high salinity was also observed during reproductive stage (Fig. 1c). Since we have carried out the northern blot analysis for three lines UT64, UT66 and UT71 (Fig. 1b), we further investigated the effect of expression abundance on the tolerance to both abiotic stresses. <br>
 +
The over-expressed OSRIP18 gene exhibits different expression abundance among different transgenic lines. However, these lines showed the similar tolerance to both PEG and high salinity stresses.
 +
 
 +
*Global gene expression changes by Microarray analysis showed that more than 100 probe sets were detected with up-regulated expression abundance while signals from only three probe sets were down-regulated after over-expression of ''OSRIP18''. Most of them were not regulated by drought or high salinity stresses<ref name="ref1"/>.
 +
 
 +
*Ectopic expression of this gene in rice increased its tolerance to 30% PEG stress<ref name="ref2"/>.
 +
 
 +
*Transgenic plants showed significantly higher tolerance to high salinity stress.Two transgenic lines UT66 and UT71 showed that the integrated ''OSRIP18'' were also expressed in all tested tissues with differential transcript abundance<ref name="ref1"/>.
 +
 
 +
*Transgenic plants exhibited no significant differences in response to both biotic stresses (Megnaporthe grisea) and Xoo (Xanthomonas oryzae pv oryzae) as well as to cold stress when compared with WT plantsas<ref name="ref1"/>.
 +
 
 +
*The transgenic plants over-expressing ''OSRIP18'' showed no obvious phenotype difference during vegetative or reproductive development stages under normal growth conditions. This gene was induced by PEG and high salinity treatments during panicle development<ref name="ref1"/><ref name="ref2"/>.
  
 
===Evolution===
 
===Evolution===

Revision as of 08:42, 12 January 2015

Oryza sativa Ribosome-inactivating protein gene 18 (OSRIP18) may be potentially useful in further improving plant tolerance to various abiotic stresses by over-expression[1].

Annotated Information

Function

  • OSRIP18(Os07g0556800) might play a role in increasing tolerance to drought and high salinity during panicle development but not in seedling stage. After overexpression, active expression can be detected in all tested developmental stages and as a result, the transgenic plants exhibited higher tolerance to both stresses in these stages[1]. It means the gene may play a role as a member of natural defense system against various environmental conditions including drought and high salinity stresses[2].
  • OSRIP18 may play a role in pollen development by sensing different environmental cues, the gene may play important roles as a member of natural defense system against varying environmental conditions during pollen development[2].
  • OSRIP18 and other rice RIP genes may be potentially useful for developing new plant varieties with higher tolerance to various stresses[2].

GO assignment(s): GO:0017148, GO:0030598

Mutation

transgenic lines[1]:

  • UT66
  • UT71
  • UT3
  • UT64

To investigate the biological functions of the OSRIP18 gene, it was ectopically expressed under the control of 35S promoter. Totally, 33 transgenic plants were generated with this construct. These plants were integrated 1–4 copies of the construct by southern blot analysis. Among them, 11 independent transgenic plants contained single copy insertion of the T-DNA and they were used for further investigation. All of them showed significantly increased tolerance to drought and high salinity stresses.

Expression

Figure 1.Phenotypic characterization of transgenic plants overexpressing OSRIP18.(from reference [1]).
  • Transgenic plants overexpressing OSRIP18[1]:
    • 11 independent transgenic plants with single copy of T-DNA insertion were fertile and the seeding rates had no co-relation with ectopic expression this gene. Some of the data were shown in Fig. 1a.
    • After treatment for 2 h under 30% PEG solution, transgenic plants still showed normal leaf phenotype while WT plants exhibited withered and curved leaves (Fig. 1b). The result suggested that ectopic expression of this gene in rice increased its tolerance to 30% PEG stress.
    • The increased tolerance to drought and high salinity was also observed during reproductive stage (Fig. 1c). Since we have carried out the northern blot analysis for three lines UT64, UT66 and UT71 (Fig. 1b), we further investigated the effect of expression abundance on the tolerance to both abiotic stresses.

The over-expressed OSRIP18 gene exhibits different expression abundance among different transgenic lines. However, these lines showed the similar tolerance to both PEG and high salinity stresses.

  • Global gene expression changes by Microarray analysis showed that more than 100 probe sets were detected with up-regulated expression abundance while signals from only three probe sets were down-regulated after over-expression of OSRIP18. Most of them were not regulated by drought or high salinity stresses[1].
  • Ectopic expression of this gene in rice increased its tolerance to 30% PEG stress[2].
  • Transgenic plants showed significantly higher tolerance to high salinity stress.Two transgenic lines UT66 and UT71 showed that the integrated OSRIP18 were also expressed in all tested tissues with differential transcript abundance[1].
  • Transgenic plants exhibited no significant differences in response to both biotic stresses (Megnaporthe grisea) and Xoo (Xanthomonas oryzae pv oryzae) as well as to cold stress when compared with WT plantsas[1].
  • The transgenic plants over-expressing OSRIP18 showed no obvious phenotype difference during vegetative or reproductive development stages under normal growth conditions. This gene was induced by PEG and high salinity treatments during panicle development[1][2].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.


Knowledge Extension

Labs working on this gene

  • Rice Functional Genomics Group, Temasek Life Sciences Laboratory, 1 Research Link, The National University of Singapore, Singapore 117604, Singapore
  • Republic Polytechnic, 9 Woodlands Ave 9, Singapore 738964, Singapore

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Jiang S Y, Bhalla R, Ramamoorthy R, et al. Over-expression of OSRIP18 increases drought and salt tolerance in transgenic rice plants[J]. Transgenic research, 2012, 21(4): 785-795.
  2. 2.0 2.1 2.2 2.3 2.4 Jiang S Y, Ramamoorthy R, Bhalla R, et al. Genome-wide survey of the RIP domain family in Oryza sativa and their expression profiles under various abiotic and biotic stresses[J]. Plant molecular biology, 2008, 67(6): 603-614.

Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref4" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref5" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref6" defined in <references> is not used in prior text.


Structured Information

Gene Name

Os07g0556800

Description

Ribosome-inactivating protein family protein

Version

NM_001066499.1 GI:115472730 GeneID:4343572

Length

1037 bp

Definition

Oryza sativa Japonica Group Os07g0556800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:22882458..22883494

Sequence Coding Region

22882542..22883438

Expression

GEO Profiles:Os07g0556800

Genome Context

<gbrowseImage1> name=NC_008400:22882458..22883494 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:22882458..22883494 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaa</cdnaseq>

Protein Sequence

<aaseq>MVKPAAVLLLLYLPLLATPTRIGLSRNPFVPPPNSVPTIDRTEM DVSTSPYRDLIKKWRDLVLLNTRPEVMVPEDHPVLAPQYDDTVPPERLLLPKLVANGD KTATLALRDSNIYFIGFANKAGQWFSFKDRNDLPPSFRARPLSFGVDYASIAGFRKNL PNYPLGRRQTEWAVKVLSEYDPNRTDEATIKRAVVIILLTFCEALRFFPIRNAVEIGW DSVAYITSTDADRLVCWGQISYMLEYSFMSGHSWDSEEQRTRLKNLARDCKIFNEPQA LETVDVLEYGAILGAKSTNWLY</aaseq>

Gene Sequence

<dnaseqindica>57..953#aaaaaaagcccaaaccttcaagttcacctttgcttaattgcaccagcttagccgtcatggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaatgcaaggtgtaagcgccctcctagctaatataggcgcacttccacaatttatgtactccaatattatgcaactcacatggtgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0556800, RefSeq:Os07g0556800