Difference between revisions of "Os08g0441100"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
−
Please input one-sentence summary here.
+
'''''OsCIPK06''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases) in rice<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Please input function information here.
+
*''OsCIPK06'' contains '''at least one of the three cis-elements''' in the promoter regions<ref name="ref1"/>.
 +
 
 +
*''OsCIPK6'':''OsCIPK27'' is duplicated genes<ref name="ref2"/>. 
  
 
===Expression===
 
===Expression===
−
Please input expression information here.
+
*''OsCIPK6'' is commonly '''up-regulated''' in the '''salt and drought stresses'''<ref name="ref2"/>. ''OsCIPK06'' and ''OsCIPK16'', and not ''OsCIPK27'', in subgroup II showed '''up-regulation''' in response to '''drought stress'''<ref name="ref3"/>.
 +
 
 +
*''OsCIPK06'' showed preferred expression in most reproductive tissues/organs except for the stigma/ovary. In addition, this gene showed predominant expression in vegetative tissues/organs of indica samples compared to ''OsCIPK16'' and ''OsCIPK27''<ref name="ref3"/>.  
  
 
===Evolution===
 
===Evolution===
−
Please input evolution information here.
+
''OsCIPK06'' belongs to '''subgroup II''' of ''OsCIPK'' family<ref name="ref3"/>.  
 +
 
 +
===Knowledge Extension===
 +
[[File: OsCIPK family Functional.png|right|thumb|260px|'''Figure 1.''' ''Functional gene network analysis of OsCIPK family members.(from reference <ref name="ref3"/>).'']] 
 +
*From real-time RT-PCR analyses, ''Giong et al.'' identified 16 OsCIPK genes showing a significant up- or down-regulation in response to '''drought stress'''. Using the probable functional gene network tool, RiceNet, ''Giong et al.'' generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 1)<ref name="ref3"/>.
 +
*More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 1) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 1) under drought stress to all the elements in this network<ref name="ref3"/>.
 +
*Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)<ref name="ref3"/>.
 +
 
 +
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli<ref name="ref4"/>. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref4"/>.
 +
 
  
−
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Please input related labs here.
+
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
 +
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, Dhaula Kuan, New Delhi-110021, India
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref2">
 +
Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
 +
</ref>
 +
* <ref name="ref3">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref4">
 +
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214. 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:19, 29 January 2015

OsCIPK06 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases) in rice[1].

Annotated Information

Function

  • OsCIPK06 contains at least one of the three cis-elements in the promoter regions[1].
  • OsCIPK6:OsCIPK27 is duplicated genes[2].

Expression

  • OsCIPK6 is commonly up-regulated in the salt and drought stresses[2]. OsCIPK06 and OsCIPK16, and not OsCIPK27, in subgroup II showed up-regulation in response to drought stress[3].
  • OsCIPK06 showed preferred expression in most reproductive tissues/organs except for the stigma/ovary. In addition, this gene showed predominant expression in vegetative tissues/organs of indica samples compared to OsCIPK16 and OsCIPK27[3].

Evolution

OsCIPK06 belongs to subgroup II of OsCIPK family[3].

Knowledge Extension

Figure 1. Functional gene network analysis of OsCIPK family members.(from reference [3]).
  • From real-time RT-PCR analyses, Giong et al. identified 16 OsCIPK genes showing a significant up- or down-regulation in response to drought stress. Using the probable functional gene network tool, RiceNet, Giong et al. generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 1)[3].
  • More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 1) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 1) under drought stress to all the elements in this network[3].
  • Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)[3].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli[4]. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].


Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  • Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, Dhaula Kuan, New Delhi-110021, India

References

  1. ↑ 1.0 1.1 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. ↑ 2.0 2.1 Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
  3. ↑ 3.0 3.1 3.2 3.3 3.4 3.5 3.6 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  4. ↑ 4.0 4.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Structured Information

Gene Name

Os08g0441100

Description

Similar to PnC401 homologue

Version

NM_001068442.1 GI:115476621 GeneID:4345687

Length

1141 bp

Definition

Oryza sativa Japonica Group Os08g0441100, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:21555459..21556599

Sequence Coding Region

21555461..21556375

Expression

GEO Profiles:Os08g0441100

Genome Context

<gbrowseImage1> name=NC_008401:21555459..21556599 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:21555459..21556599 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>aagccggagaacctgctgctcgacgaggccgggaacctcaaggtggtcgacttcggcctcagcgcgctcgccgaccacgcccgcgccgacggcctcctccacacgctctgcggcacgccggggtacgccgcgcccgaggtgctccgcgacaagggctacgacggcgccaaggccgacctctggtcctgcggcgtcatcctctacgtgctcctcgccgggtccctcccgttccccgacgacaacatcgtcaccctgtaccggaaggcccagcgcggcgactaccggtgcccggcgtggctgtccaccgacgcgcgccgcctcatccccaggctgctcgaccccaacccgaccacccgcatcagcgtcgcgcagctcgtcgagacgccgtggttcaagaagacgtccatctccaggcctgtgagcatagagcttcctccggcctttgccgatcctgctccggctaaggaggaggccgagaaggacgagccggagacgctgaacgcgttccacctgatatcactctcggaggggttcgacctctcgccgctgttcgagggggactcggccaaggggaggcgggacggtggcatgctgttcgcgacgcgggagccagcgagcggcgtgatctcccgcctcgagggggtggcggcgcgcggcggcggccggatgcgggtgaccaagagcggcgcccgcggcgtgcgcctggagggcgcggagcgcggcggggccaagggccgcctcgccgtggccgccgacatcttcagcgtggcgccctccgtcctcgtcgtcgacgtcaagaaggacggcggcgacacgctcgagtaccgctcattctgcagcgaggagctccggccggcgctccaggacatcgtctggggcgccgccgccgacccaacgccgaccgccgccgtctga</cdnaseq>

Protein Sequence

<aaseq>KPENLLLDEAGNLKVVDFGLSALADHARADGLLHTLCGTPGYAA PEVLRDKGYDGAKADLWSCGVILYVLLAGSLPFPDDNIVTLYRKAQRGDYRCPAWLST DARRLIPRLLDPNPTTRISVAQLVETPWFKKTSISRPVSIELPPAFADPAPAKEEAEK DEPETLNAFHLISLSEGFDLSPLFEGDSAKGRRDGGMLFATREPASGVISRLEGVAAR GGGRMRVTKSGARGVRLEGAERGGAKGRLAVAADIFSVAPSVLVVDVKKDGGDTLEYR SFCSEELRPALQDIVWGAAADPTPTAAV</aaseq>

Gene Sequence

<dnaseqindica>3..917#tcaagccggagaacctgctgctcgacgaggccgggaacctcaaggtggtcgacttcggcctcagcgcgctcgccgaccacgcccgcgccgacggcctcctccacacgctctgcggcacgccggggtacgccgcgcccgaggtgctccgcgacaagggctacgacggcgccaaggccgacctctggtcctgcggcgtcatcctctacgtgctcctcgccgggtccctcccgttccccgacgacaacatcgtcaccctgtaccggaaggcccagcgcggcgactaccggtgcccggcgtggctgtccaccgacgcgcgccgcctcatccccaggctgctcgaccccaacccgaccacccgcatcagcgtcgcgcagctcgtcgagacgccgtggttcaagaagacgtccatctccaggcctgtgagcatagagcttcctccggcctttgccgatcctgctccggctaaggaggaggccgagaaggacgagccggagacgctgaacgcgttccacctgatatcactctcggaggggttcgacctctcgccgctgttcgagggggactcggccaaggggaggcgggacggtggcatgctgttcgcgacgcgggagccagcgagcggcgtgatctcccgcctcgagggggtggcggcgcgcggcggcggccggatgcgggtgaccaagagcggcgcccgcggcgtgcgcctggagggcgcggagcgcggcggggccaagggccgcctcgccgtggccgccgacatcttcagcgtggcgccctccgtcctcgtcgtcgacgtcaagaaggacggcggcgacacgctcgagtaccgctcattctgcagcgaggagctccggccggcgctccaggacatcgtctggggcgccgccgccgacccaacgccgaccgccgccgtctgatgccaccattgttagcgtccaaagtcattgtgtcacagtagccgatgctgttcttcctcctcctgtgcttgattcgatagcgacgtgcatgaactagtatcgctgtttgggtggtgggggcagttggcaagaacaaatctgtatctctgcctcaaaagcaacagcatttttttttcttttgcacaagttgcaattgtttttgtgatggtctttgcttacatctg</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0441100, RefSeq:Os08g0441100

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os08g0441100&oldid=184793"