Difference between revisions of "Os03g0634400"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
'''''OsCIPK07''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases) in rice<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*[[Os12g0603700|''OsCIPK4'']]:''OsCIPK7'' are gene pairs<ref name="ref2"/>. Expression of ''OsCIPK07'' in the internode is quite unique suggesting related developmental roles<ref name="ref3"/>.
 +
 
 +
*''OsCIPK07'', [[Os03g0339900|''OsCIPK10'']], [[Os01g0759400|''OsCIPK12'']], and [[Os12g0113500|''OsCIPK14'']] showed a similar diurnal pattern to ''OsGI''<ref name="ref3"/>.  
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*''OsCIPK07'' was '''induced by salinity stress''' and '''ABA treatment'''<ref name="ref1"/>.
 +
 
 +
*In subgroup VII, ''OsCIPK04'' showed down-regulation but expression of ''OsCIPK07'' showed '''fluctuation''' such as downregulation at 2 and 4 h after drought stress and up-regulation
 +
at 6 and 8 h<ref name="ref3"/>.  
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[Os12g0603700|''OsCIPK4'']] and ''OsCIPK07'' belong to '''subgroup VII''' of ''OsCIPK'' family<ref name="ref3"/>.
 +
 
 +
===Knowledge Extension===
 +
*Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses<ref name="ref1"/>.
 +
 
 +
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref4"/>.
  
You can also add sub-section(s) at will.
+
*As a plant-specific Ca<sup>2+</sup> sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K<sup>+</sup> response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others<ref name="ref4"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez
 +
Road, Dhaula Kuan, New Delhi-110021, India
 +
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement,
 +
Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref2">
 +
Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
 +
</ref>
 +
* <ref name="ref3">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref4">
 +
CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003. 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:52, 29 January 2015

OsCIPK07 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases) in rice[1].

Annotated Information

Function

  • OsCIPK4:OsCIPK7 are gene pairs[2]. Expression of OsCIPK07 in the internode is quite unique suggesting related developmental roles[3].

Expression

  • OsCIPK07 was induced by salinity stress and ABA treatment[1].
  • In subgroup VII, OsCIPK04 showed down-regulation but expression of OsCIPK07 showed fluctuation such as downregulation at 2 and 4 h after drought stress and up-regulation

at 6 and 8 h[3].

Evolution

OsCIPK4 and OsCIPK07 belong to subgroup VII of OsCIPK family[3].

Knowledge Extension

  • Calcineurin B-like protein-interacting protein kinases(CIPKs) are a group of typical Ser/Thr protein kinases that mediate calcium signals. Some genes in the CIPK family of rice are involved in the responses to multiple abiotic stresses, whereas some genes of the family are responsive to specific stresses[1].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].
  • As a plant-specific Ca2+ sensor relaying pathway, the CBL–CIPK pathway has some crosstalk with other signaling pathways. In addition, research has shown that there is crosstalk between the CBL–CIPK pathway and the low-K+ response pathway, the ABA signaling pathway, the nitrate sensing and signaling pathway, and others[4].

Labs working on this gene

  • Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez

Road, Dhaula Kuan, New Delhi-110021, India

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement,

Huazhong Agricultural University, Wuhan 430070, China

  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea

References

  1. 1.0 1.1 1.2 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
  3. 3.0 3.1 3.2 3.3 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  4. 4.0 4.1 CHEN X, GU Z, LIU F, et al. Molecular Analysis of Rice CIPKs Involved in Biotic and Abiotic Stress Responses[J]. Chinese Journal of Rice Science, 2010, 6: 003.

Structured Information

Gene Name

Os03g0634400

Description

Protein kinase-like domain containing protein

Version

NM_001057253.1 GI:115454234 GeneID:4333516

Length

1559 bp

Definition

Oryza sativa Japonica Group Os03g0634400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:24986674..24988232

Sequence Coding Region

24986819..24988162

Expression

GEO Profiles:Os03g0634400

Genome Context

<gbrowseImage1> name=NC_008396:24986674..24988232 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:24986674..24988232 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccgccaccaagagcaaggcggccaagaagggcgctccgctcctcggcaagtacgagctcggccgcctcctcggccgcggcaccttcgccaaggtctaccacgcccgctccctcgcccccggcgccgaccccgtcgccgtcaaggtgctcgacaagcccgacctcgccgccgccggcgccggcatggccacccgcgtcctccgcgaggtcgccgccatgcgccgcctccgccaccccaacgtcctccgcctccacgaggtgctcgccacgcgctccaaggtgtacctcgtcatggagctcgcccccggcggcgacctcctctccaggctcgcctcgctgccgtcgcgccgcctccccgagcacgccgcgcagcgggtgttcctccagctggtgtccgcgctcatctactgccacgcgcggggcgtgtcccaccgcgacgtcaagccgcagaacgtgctcctcgacgcacacggcaacctcaaggtctccgacttcggcctcgccgcgctcccggactcgctccgcgacgacgggcgcctgcacaccgcgtgcggcaccccggcgttcgcggcgcccgaggtgctccgccgcaaggcctacgacggcgccaaggccgacgcgtggtcctgcggcgtcatcctcttcgtcctcctcgccggccacctgccgttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgcgctcccgcggtgggtgtcgcagccggcgcgccgcctcgtgtcgcgcctcctcgacccgaacccggccacccgcctcgccgtcgccgagctcgccacccacccgtggttcaagcgctcgctcagcctcgactcgcagctcggcagcctcctcggcggccagccggagcgggagctggcgttccaggcgccgccgccactgaacgcgttcgacatcatatccatgtcgccggggctcgacctgtccgggctgttcggcgagagcaagcgccgccgggagaagcggttcgtgacgacggcgtcgccggagcggacggtggagcggctcggccaggcgggcgccaagctcggctacttcatggtgggcaagaagggcgtcgaacgcctgcccctgggcggcctctcgggcctcgtcgccatgtccatggagatgtcggaggtgtcgccgtcgatgatgctcgtcgagctgaggctggagggaggcgacgacggcgacggcgacggcggtgccgaggagttcgggtgggaggagctcagggcggagctcggcgacgacgtggtgatggcatggcatggctgcgatggagggaagaaagacaaggaagggattcttttgtag</cdnaseq>

Protein Sequence

<aaseq>MAATKSKAAKKGAPLLGKYELGRLLGRGTFAKVYHARSLAPGAD PVAVKVLDKPDLAAAGAGMATRVLREVAAMRRLRHPNVLRLHEVLATRSKVYLVMELA PGGDLLSRLASLPSRRLPEHAAQRVFLQLVSALIYCHARGVSHRDVKPQNVLLDAHGN LKVSDFGLAALPDSLRDDGRLHTACGTPAFAAPEVLRRKAYDGAKADAWSCGVILFVL LAGHLPFDDSNIADMCRKAHRREYALPRWVSQPARRLVSRLLDPNPATRLAVAELATH PWFKRSLSLDSQLGSLLGGQPERELAFQAPPPLNAFDIISMSPGLDLSGLFGESKRRR EKRFVTTASPERTVERLGQAGAKLGYFMVGKKGVERLPLGGLSGLVAMSMEMSEVSPS MMLVELRLEGGDDGDGDGGAEEFGWEELRAELGDDVVMAWHGCDGGKKDKEGILL</aaseq>

Gene Sequence

<dnaseqindica>71..1414#atagtaaccagctgctgctgctgccgccctcttctttgtgttgccttgttgttggtgtcgcgcgcccgccatggccgccaccaagagcaaggcggccaagaagggcgctccgctcctcggcaagtacgagctcggccgcctcctcggccgcggcaccttcgccaaggtctaccacgcccgctccctcgcccccggcgccgaccccgtcgccgtcaaggtgctcgacaagcccgacctcgccgccgccggcgccggcatggccacccgcgtcctccgcgaggtcgccgccatgcgccgcctccgccaccccaacgtcctccgcctccacgaggtgctcgccacgcgctccaaggtgtacctcgtcatggagctcgcccccggcggcgacctcctctccaggctcgcctcgctgccgtcgcgccgcctccccgagcacgccgcgcagcgggtgttcctccagctggtgtccgcgctcatctactgccacgcgcggggcgtgtcccaccgcgacgtcaagccgcagaacgtgctcctcgacgcacacggcaacctcaaggtctccgacttcggcctcgccgcgctcccggactcgctccgcgacgacgggcgcctgcacaccgcgtgcggcaccccggcgttcgcggcgcccgaggtgctccgccgcaaggcctacgacggcgccaaggccgacgcgtggtcctgcggcgtcatcctcttcgtcctcctcgccggccacctgccgttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgcgctcccgcggtgggtgtcgcagccggcgcgccgcctcgtgtcgcgcctcctcgacccgaacccggccacccgcctcgccgtcgccgagctcgccacccacccgtggttcaagcgctcgctcagcctcgactcgcagctcggcagcctcctcggcggccagccggagcgggagctggcgttccaggcgccgccgccactgaacgcgttcgacatcatatccatgtcgccggggctcgacctgtccgggctgttcggcgagagcaagcgccgccgggagaagcggttcgtgacgacggcgtcgccggagcggacggtggagcggctcggccaggcgggcgccaagctcggctacttcatggtgggcaagaagggcgtcgaacgcctgcccctgggcggcctctcgggcctcgtcgccatgtccatggagatgtcggaggtgtcgccgtcgatgatgctcgtcgagctgaggctggagggaggcgacgacggcgacggcgacggcggtgccgaggagttcgggtgggaggagctcagggcggagctcggcgacgacgtggtgatggcatggcatggctgcgatggagggaagaaagacaaggaagggattcttttgtaggacatggactttgtcacatgtatgatgatgtatattagtaggattttgtggcattgttgtgtcaaagattatagattgttagttcaatctaattacgatgttttgtgactaaattgttggtaggaatggatctagatcatttgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0634400, RefSeq:Os03g0634400