Difference between revisions of "Os01g0536000"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
'''''OsCIPK06''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases) in rice<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Almost all OsCIPK proteins contain the complete protein kinase domain (except [[Os07g0637000|''OsCIPK21'']]) and the NAF domain (except ''OsCIPK8''). ''OsCIPK08'' has lost the region containing the FISL/NAF motif, but it contains the full N-terminal catalytic domain (sharing sequence homology with SNF)<ref name="ref1"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0007165 GO:0007165]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
''OsCIPK08'' was '''induced by salinity stress'''<ref name="ref1"/>, the expression of ''OsCIPK08'' was relatively high in the '''shoot'''<ref name="ref2"/>.  
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
''OsCIPK08'' belongs to '''subgroup I''' of ''OsCIPK'' family<ref name="ref2"/>.
 +
 
 +
===Knowledge Extension===
 +
[[File: OsCIPK family Functional.png|left|thumb|260px|'''Figure 1.''' ''Functional gene network analysis of OsCIPK family members.(from reference <ref name="ref1"/>).'']] 
 +
*From real-time RT-PCR analyses, ''Giong et al.'' identified 16 OsCIPK genes showing a significant up- or down-regulation in response to '''drought stress'''. Using the probable functional gene network tool, RiceNet, ''Giong et al.'' generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 1)<ref name="ref2"/>.
 +
*More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 1) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 1) under drought stress to all the elements in this network<ref name="ref2"/>.
 +
*Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)<ref name="ref2"/>.
  
You can also add sub-section(s) at will.
+
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli<ref name="ref3"/>. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref3"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref2">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref3">
 +
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 08:29, 29 January 2015

OsCIPK06 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases) in rice[1].

Annotated Information

Function

Almost all OsCIPK proteins contain the complete protein kinase domain (except OsCIPK21) and the NAF domain (except OsCIPK8). OsCIPK08 has lost the region containing the FISL/NAF motif, but it contains the full N-terminal catalytic domain (sharing sequence homology with SNF)[1].


GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Expression

OsCIPK08 was induced by salinity stress[1], the expression of OsCIPK08 was relatively high in the shoot[2].

Evolution

OsCIPK08 belongs to subgroup I of OsCIPK family[2].

Knowledge Extension

Figure 1. Functional gene network analysis of OsCIPK family members.(from reference [1]).
  • From real-time RT-PCR analyses, Giong et al. identified 16 OsCIPK genes showing a significant up- or down-regulation in response to drought stress. Using the probable functional gene network tool, RiceNet, Giong et al. generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 1)[2].
  • More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 1) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 1) under drought stress to all the elements in this network[2].
  • Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)[2].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli[3]. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[3].

Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea

References

  1. 1.0 1.1 1.2 1.3 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. 2.0 2.1 2.2 2.3 2.4 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  3. 3.0 3.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Structured Information

Gene Name

Os01g0536000

Description

Similar to CBL-interacting serine/threonine-protein kinase 24 (EC 2.7.1.37) (SNF1-related kinase 3.11) (SALT OVERLY SENSITIVE 2 protein)

Version

NM_001049794.1 GI:115437291 GeneID:4326419

Length

8329 bp

Definition

Oryza sativa Japonica Group Os01g0536000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:21126107..21134435

Sequence Coding Region

21126517..21126612,21127124..21127198,21127298..21127354,21128220..21128336,21128878..21128991
,21129310..21129432,21129581..21129670,21130500..21130625,21132677..21132730
,21132803..21132877,21132957..21133064,21133291..21133362,21133473..21133535
,21134110..21134280

Expression

GEO Profiles:Os01g0536000

Genome Context

<gbrowseImage1> name=NC_008394:21126107..21134435 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:21126107..21134435 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgggcggaggggcgctgcggcgggtggggaagtacgaggtggggcggacgatcggggaggggacgttcgccaaggtgaagttcgcgcagaacacggagagcggggagagcgtcgccatgaaggtggtcgaccgctcctccatcctcaagcacaagatggcggatcagattaagagagagatatctataatgaagcttgtgaggcatccgaatgtggttagactacacgaagtcttggcaagccggaagaagatatttataatcttggagttcatcactggcggtgaactatttgataaaataattcgtcatggaagactcaatgaagctgatgcacgcagatactttcagcagctcattgatggtgttgatttttgtcacagcaaaggtgtctaccatcgagatttaaagcccgaaaatctcctccttgattcccaaggaaatcttaaaatatcagactttggactcagcgcctggcctgctcagggtggtgcccttttacgtactacctgtggaaccccaaattatgttgccccagaggttctcagtcataaaggatatgatggagcacttgctgatacatggtcatgtggagttattctatatgtcctgttggcaggttatcttccatttgatgaagttgatttgactaccctttacgggaagatagagagtgcagaatattcattcccagcttggtttcctaatggtgccaagtcacttattcacagaattcttgaccctaatccagataaaagaatcaggatagaagagatcaggaatgatgaatggtttaagaagaattatgaacctaccagagaaattgaaagtgaagaagtcaatcttgatgatgtcaatgcagcttttgatgatcctgaggaagacgctgaccatactttagatgacgaagcaggacctttgacactcaatgcattcgacctaataattctatctcaaggcttgaaccttgcagcactatttgatcgccgacaggactatgacaagcttcaaaatagatttttatcacgcaaaccagcaaaggttatcatgtcaagcatggaggttgttgctcagtcaatggggtacaagacacacattcgcaattataagatgagggtggaaggtctaaatgcaaataagacaagtcatctcgcagttatgcttgaaatttttgaagttgccccatcgatcttcatgattgaactgcaaagagcagcgggagacacctccgattataacaagtttataaataattactgcagcaaattagacgatatcatttggaattttccaattgagaagagcaaatcaaggatatcgcggctatcgaagcgctag</cdnaseq>

Protein Sequence

<aaseq>MVGGGALRRVGKYEVGRTIGEGTFAKVKFAQNTESGESVAMKVV DRSSILKHKMADQIKREISIMKLVRHPNVVRLHEVLASRKKIFIILEFITGGELFDKI IRHGRLNEADARRYFQQLIDGVDFCHSKGVYHRDLKPENLLLDSQGNLKISDFGLSAW PAQGGALLRTTCGTPNYVAPEVLSHKGYDGALADTWSCGVILYVLLAGYLPFDEVDLT TLYGKIESAEYSFPAWFPNGAKSLIHRILDPNPDKRIRIEEIRNDEWFKKNYEPTREI ESEEVNLDDVNAAFDDPEEDADHTLDDEAGPLTLNAFDLIILSQGLNLAALFDRRQDY DKLQNRFLSRKPAKVIMSSMEVVAQSMGYKTHIRNYKMRVEGLNANKTSHLAVMLEIF EVAPSIFMIELQRAAGDTSDYNKFINNYCSKLDDIIWNFPIEKSKSRISRLSKR</aaseq>

Gene Sequence

<dnaseqindica>7824..7919#7238..7312#7082..7138#6100..6216#5445..5558#5004..5126#4766..4855#3811..3936#1706..1759#1559..1633#1372..1479#1074..1145#901..963#156..326#atcccccatctcaatggcgatgtcgagctgagcaccaccctagcggtggagtaggggagctgtggtcggcggcggccgccgccagttgggtgtctcggagtgagaccgggagaggcggcggagggagctcagggagggagggaggaggggcggcgatggtgggcggaggggcgctgcggcgggtggggaagtacgaggtggggcggacgatcggggaggggacgttcgccaaggtgaagttcgcgcagaacacggagagcggggagagcgtcgccatgaaggtggtcgaccgctcctccatcctcaagcacaagatggcggatcaggtgagcccccatctatctcttctgtttttttttcctttttttgttctctctatttgcgtgttgatcaagagattttgctgtactagcttagcttgggaattaattagtgtatgccacggatttgtctagcgccttgagacacagaatggatgagggagattgtttaattcgaccctcttttcatcctcttttgcgccaaattctactcggtttgtcaatggtgggtttgatgcttcatgtccaattggcgtctagcttgcagcttcctttccccacaacaaagtgttaacagtggtggtaccaggattgttgaatcgaatcgcaattttaaacttccgccgagcagtttgttcttctgtatatacctattaagatattgttgttataaaagaaaaaaaaaagtaaggtacctatgtcaagaagcacccctttgtaaaaaagaactcacaggtttatgcttgtaagggaaaggcagttttagctgttctagttttgtgttgttgagctgcgtaagttagctgaatcctgatgtatcagggtgataaaacaggagcttacttaattatttctgcagattaagagagagatatctataatgaagcttgtgaggcatccgaatgtggttagactacacgaagtacaccctctttcccttttctctctttaagttttgttgtttacttctttgttctctcttgctttttccaagtgctgattgggtgatcatatctgttctgttatgtgcaggtcttggcaagccggaagaagatatttataatcttggagttcatcactggcggtgaactatttgataaaatagtaaggccctgcttgttaatgataagtgtccttttcagtgtcattttctcgatatgacctatgaaaaaattgaagttaaattagttcttgtatctgttgcctagttgtctacctcattacttctggattgaacaatcgccacttgtgcttgttggatttaacacacaaaaatgagttttcaaatctatgttgaagcttagttattctgggaacaatgccatttcagattcgtcatggaagactcaatgaagctgatgcacgcagatactttcagcagctcattgatggtgttgatttttgtcacagcaaaggtgtctaccatcgagatttaaaggtgataagtcaaaagaaaaatacgaaaactttttgtgtttagtttgtgggctttttgattttattttgtatgtatgcagcccgaaaatctcctccttgattcccaaggaaatcttaaaatatcagactttggactcagcgcctggcctgctcaggtccatacctttctgaaggcttgtccaatattcatatccttttgtcgagttatttagtttgttcttgtgcagggtggtgcccttttacgtactacctgtggaaccccaaattatgttgccccagaggtgagtgacatctgaatcacatgctttgctttgagttttcctagatagaaaacattaaaattgtcttctgcaacaaagggtggtttaaatatgggttaattggatccatgccactgcaactttgccaaattgaaaaaatgccactactattcatcatatcggctacatgccactcgaaatttctaaaattggaaccatgccactccagtcagtttttccgtcctcctctctcacgccgtctctattcccgtcattatcccccctcccttcccatcctcctgctcctaggtggccggggacagcaccaccaccttcgtcgtcctcaccggcgcaagggtcggcggcgccggtgcacgaagacgaggctggcctgtggttcccgttcgcggactcgctggagaaggacatcttctcggacctcttctacgaggcgcccgtcgcggcggcggcaacggctgcggctgctggcctaggcgccgatggcgacagcgacggcgaaggcaagccttgcaaggacgatgcggcaatggcggaggagcgtggcgggccgggcgcggcgcgacctgatgccgccgcccaagtcgacgcccctcttctctttattccccacttctctccaccacgtccatgatgttagccgtcgcgccggggaacgggttgccggcacggaggttgttgtcggcgtccatcaccctgtacaccaccttgtgcgtcggcttgccgtgctcgtccacgccattctctgcaaagatttcacgtatctcactgtcaatttgacaaatgaactcatccaatccagcgacagcaacatctgtatggatttaacaagaatggaccaagcaagatcgaagcagtcggcggcttggcgccgcgggggctgcccatgccaagggcctcacggccgaggcaatgcggcggccgtggcgccgcatgtcggggtccccgaccgccgacactttgccgccgccattcgtctcgagtctcttgatggactgcgccaccaagtagcacgagatggcgaggacttgacggacccgtgggcggcggcgggggccgccgccgccaaggcgtccgcagaggccccgcgccgctggagcggaggcggagggcaagggacgccgagctgtccgcgctcgcgtcggccacccgtgaggctgtgaccgctcgcgccgccgtgttccgggagccgtccccggcgccgttggacgcgtcgtcgacggcggggcggcgcagagctcccgcccgtggtgctgcgcgcgtcgtcgctgatccagcggtggcgggagatcgaggcgatggggcccgccacgtcgcggccctacgacctggccttcgactccgacggcggctcgccgcgggccacgtggggtgcatcgtcaagaagctcagtggcacgtcgttgccgccgccgctgtactcgatccacgatgggaggtctcgggagccgctgctgccgtcctcgacgccatctgcggcgggagtgctcgggagctgccggcggcgtcgccgctgtcctttgcagtcgcacggagaaagaagagggaaatggaaacgattaaacggtggaacgagacggtgtgagagaggagacggaaaaagggacgagagtggcatggttctaattttaaaaatttctagtggcatgtagctaatatgatgaatagtagtggtattttttcaatttcgtatagttgcagtggcatggatccaattaaccctttaaatataccttcatcctaagatgtcagattactcagttaaacatgtgtgatggaatactcatacatttatccttcaggcaggttgagtaacattgttccaccgtgtaacttaagacatcttctctaaaaaaatgtaaaaaataaaaagtgatataactagaactgttttttatctctatactgaatgagccaaatatgcatgattgatatctcttgattctttatttggaaaaatgctttacttttcattctcagtaaaaccatgtgatgtgtttcatatgattatagataatgtgttcactgcaacctttaactccttgtatggatcaggttctcagtcataaaggatatgatggagcacttgctgatacatggtcatgtggagttattctatatgtcctgttggcaggttatcttccatttgatgaagttgatttgactaccctttacgggaaggtttgtttcttctaacctatggcaacttttttgaagctcaaataagtatattgcaacccatttatgattttgtgtcagtgtatatcatattggcacatgatctctttgtatggaagatcagatctcatgacatttacttgtatttgcttttactatacactatgtgcttacgtttattatctagccactcatttaagcatgattagtggtattagtttgtgaaatccatgtgaaaacaatatcaaacatactcggtacttctcagtgcatagatagctaagtagcttatgtaatgtagtgtgttgctagtagttaaagattacagatcctggcagtggctctgatacgtgagcatagtgatctcatacctgctttcctactgctgaaacattccggcaagtaagaaatgtaagcttgccgaaacaactaaccaactaaaaggaaattaacctcggcatcctttagaataaactagttaacatgctactactttcaataagagaattagcagagaagctggggagcacaacaacaatagcagactcattacacatggcttcatagctaaatcctctccttttcgctcttgtttctcttttctttttggttggtggaagtataaacatttgtattccattctagtaggactgattaagagatatatctatttgcatatttcaggttgagatgcatatagctatttttattttctagatttgaatattagttcaacatatgccttgatggatggaatagaagtttttatctaaaattgtttttcttttgtacagaatatacaaatttatatctgtctatttgcttaatacagatagagagtgcagaatattcattcccagcttggtttcctaatggtgccaagtcacttattcacagaattcttgaccctaatccagataaagtaagtaaagttatagaagtgtttagctaaagaaaatctccattggctgatatgaattcaatgaattatagtttagatacatcacacctctagatactgattttcattggcattttgttgactcaatatgaattttgacttggaacagagaatcaggatagaagagatcaggaatgatgaatggtttaagaagaattatgaacctaccagagaaattgaaagtgaagaagtcaatcttgatgatgtcaatgcagcttttgatgatcctgaggtatttatgcttactcttgtcttagaactgtttttggaaaggaatcattgcatatatatgacattttgtatgtgctacaatcttcaaaatatgctccaaatgaaagcctcggaatggaatttcagttgctccagataagaactattagcagtaactgaaactggaatttcagttgctccattgttaattatgaaatttgatcagaaagcctgtttcgcactgaagctatgctgtacgtttttacgggagctctattgtgccttttacctgtcattatataaatatataatttgtggtcctttttctgtgtgatttcaggaagacgctgaccatactttagatgacgaagcaggacctttgacactcaatgcattcgacctaataattctatctcaaggcttgaaccttgcagcactatttgatcgccgacaggtatggtgcaagacattttgtgatgtctagtgttttcgcaaactaaaagttggagtacaggactaacactgttattatgtcatgtcccagttctacattttttaattaatacgctatttgggcattaaatcatggttcttattgttattatcggtgaatattcagtttagtttaaatagtgtacatgtgatttgctgcggcagtttacattatttttgcaatcatgtattatatgcatagactaaagaaaatccatttgattcaaattattttaacatataaccagaggaaaaagacaatgatagaccatcccatctgatgatctttgttcctcttctctcaaacacaccttaatattgttgctgcccaacttgacacaattcaaactatcctctatttttattatttttgtatgtactccgcaatactggtattgcctagaagcttgtttaaatgtccatggtttaccctgtgtgtgagttttatagataattatgggtttcttctcctcggacctaatgcttgatgccttgatctacaggactatgacaagcttcaaaatagatttttatcacgcaaaccagcaaaggttatcatgtcaagcatggaggttgttgctcagtcaatggggtacaagacacacattcgcaattataaggtaaagtttgttgccccacaccctatagcttgttacaacatcacttacctattatacagatattgcaaatcatcttctccttcatcttagctgacaagcagttgttctatctattttgtgatagttagaatgtaactgttttttggttcattgtacagacatacagacatgaggatctgtagttctgttaaggtctaaattgtatcagaagaagcagcaccctgtcttgaaaagcttattgttttctggaatgtgaatatgttattttaaagtcaaataaatttcttattatcttcaatgtatcaagcctcatgtttgaacaagttgtcaagagaacgtcatttgatatgctggcatttacatttgaaattattgtctaagtagcaaccacaaactacctctgaattgacacaaaaagcatgatgatatcaaaagtattaattcattagaatgtgtttaggttgctggtctaaggggttacaataaactgtaccccaattttttgtacatatatatgcacaagttttatcaacctgagtaaacagtacttcatttcagtccttttaccactggtttaacagtattgaatggtattgccagtgatacatctctttaatttcttgtattgtttgtttgtggcctttttttttcccttttggcataacattgtctggatgctggtaaattgtgatcaaatgcgggcttacagttttaatattattcatgctgttattttgcaagtaaaagagttataatgttttgtcttgtgattttgattctcaaaacttcttttactgctaattagttagcattaccatggacatatttgattccttacatctagttgtgctattaatatattcagatgagggtggaaggtctaaatgcaaataagacaagtcatctcgcagttatgcttgaagtgagtcttgcctcttttgtaatgaagtacatctgttgttttattgccttctattatggattactccaatccttttcatcctgagtttcctctggtcagatttttgaagttgccccatcgatcttcatgattgaactgcaaagagcagcgggagacacctccgattataacaaggtcagatgcaaagagcctttcatacttgcatcatgctgtttcttgaggtcctacagccgatacaccatgtatagctaaatgcacctgatacatctaggctgtagacagcctagtgttataaagctggaaaatattttgcaatgttgttaccacagagctttacggagactgtctagaaaatagttaggtactagtagtaccagactgatgtgggacctacctgtgtacatgcatggaccgtactattcatttgctgctgtcttatttttcagtttgtgttttgtcaaagctaaataagcatgcctaatgttaaaggttaggcatgggcaaatatattcaagtagtttcttcacccaagaaatctgaaatagtaatgcttataatttcctgatgaaacttcttgcttcactagatatttttgtgaattgtataatgtaaaataaattgatctggataatggcttttgatttgctaagacatgcacaactaactccgcgtgtcttatgtgcagtttataaataattactgcagcaaattagacgatatcatttggaattttccaattgagaagagcaaatcaaggatatcgcggctatcgaagcgctagtctgctttgacatccatcatttgtatgctgttgttcaactctattttcatcttctattgccataatatttgcatttacctctacttattacctcttaaccataccggaatgctcaccactattgcaggtactatgtgtaatctaatgctatgcagcttgagtggtattgggtttgttagtggatgtatttgtagagattgccaattcaattcatctctgatcttttagttataagagatgaccatgtacaaagggccactgaaagttttggcatctcagtttctctgtacaatgtttgcagcgaggtatattaaacagtttgactgaccgccgctccctgctcatcaacacgctttgtagtttgtctcaagatgtattaatttctccctgctccattagcagcttgcatc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0536000, RefSeq:Os01g0536000