Difference between revisions of "Os01g0177900"
| Line 1: | Line 1: | ||
| − | + | As a member of ABC subfamily G ('''ABCG'''), '''''OsABCG31''''' is essential for the '''retention of leaf water'''<ref name="ref1"/><ref name="ref2"/>. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | *The ''Os01g0177900'' gene product is an ABC-2 type transporter domain containing protein, predicted to participate in the '''transport of secondary metabolites'''. It is involved in '''various plant-pathogen interactions''', and may also contribute to the '''transport of signalling molecules''' and the '''secretion of volatiles'''<ref name="ref1"/>. | |
| + | |||
| + | *One of these 10 genes encoded an ''OsABCG31'' transporter and so was taken as the '''candidate for ''Eibi1'''''. The sequence of the wild-type and mutant alleles revealed a single nucleotide difference in exon 14, predicted to alter a tryptophan codon into a TAG stop codon and thereby '''inducing a probable loss of function'''<ref name="ref2"/>. | ||
| + | |||
| + | *Characterization of both barley and rice alleles indicated that the ''ABCG31'' gene encoding a full ABCG transporter is involved in the formation of a functional cuticle. ''EIBI1'' and its rice '''ortholog''' ''OsABCG31'' may play additional roles in '''plant development'''<ref name="ref2"/>. | ||
| + | |||
| + | ===Mutation=== | ||
| + | [[File: OsABCG31 mutant1.jpg|right|thumb|300px|'''Figure 1.''' ''OsABCG31 mutant(from reference <ref name="ref2"/>).'']] | ||
| + | *''osabcg31.b'' | ||
| + | *''osabcg31.c'' | ||
| + | |||
| + | *Two independent transposon ''Oryza sativa'' 17 (''Tos17'') events within ''OsABCG31'' ('''''osabcg31.b''''' and '''''osabcg31.c''''') were identified (Fig. 1 E–G), and the association between genotype and leaf water retention was tested. | ||
| + | *Loss-of-function mutants in both wild barley and rice are '''less able to retain leaf water''' than their respective wild types. However, '''shoot development''' was compromised much '''more heavily''' in the rice mutants than in wild barley mutants. The rice mutants attained a '''plant height''' of just 3–8 cm and did not develop beyond the four- to five-leaf stage; whereas the two barley mutants attained a height of about two-thirds that of the wild type and were able to complete their life cycle through to maturity<ref name="ref2"/>. | ||
===Expression=== | ===Expression=== | ||
| − | + | *The two mutants were both '''highly sensitive to drought stress''' (as represented by ''osabcg31.b'' in Fig. 2 H), and their '''leaves''', along with those of the two wild barley ''eibi1'' mutants, were readily stained by toluidine blue, similar to ''Arabidopsis'' plants having defective cuticle<ref name="ref2"/><ref name="ref3"/><ref name="ref4"/>. | |
| + | |||
| + | *Leaf permeability is much more increased in ''hvabcg31'' and ''osabcg31'' than in ''atabcg32'', indicating the importance of ''ABCG31'' in '''monocot leaf water retention'''<ref name="ref2"/>. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | [[File: BI1 hylogeny1.jpg|right|thumb|300px|'''Figure 2.''' Phylogeny of EIBI1.(from reference <ref name="ref2"/>).'']] | |
| + | *The sequences of the '''wheat ESTs CJ579262''', CD887967 and CD902914 share '''homology''' with the rice sequences '''''Os01g0177900''''', ''Os01g0177200'' and ''Os01g0176500'', respectively<ref name="ref1"/>. | ||
| + | |||
| + | *Homologs of ''EIBI1'' were found in rice(OsABCG31), ''Arabidopsis''(AtABCG32), ''Selaginella moellendorffii'' (Smo412699), ''Physcomitrella patens''(Pp1s375_5V6.1), and ''Volvox carteri'' (Vca 40167). The monocot rice and the dicot ''Arabidopsis'' shared '''92%''' and '''71%''' sequence identities with ''EIBI1'', respectively, indicating the conservation of ''EIBI1'' in monocot and dicot plants(Figure 2)<ref name="ref2"/>. | ||
| − | + | ===Knowledge Extension=== | |
| + | Members of the diverse and ubiquitous family of ATP-binding cassette (ABC) proteins are involved in the transmembrane transport of various molecules<ref name="ref5"/><ref name="ref6"/>. ABC subfamily G (ABCG) includes both white-brown complex (WBC) half transporters and pleiotropic drug resistance (PDR) full transporters<ref name="ref7"/>. ABCG full transporters are thought to be specific to plants and fungi, where they participate in defense against pathogens and in resistance to cadmium, antimicrobial terpenoids, and auxinic compounds<ref name="ref2"/><ref name="ref8"/>. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *Laboratory of Plant Stress Ecophysiology and Biotechnology, Cold and Arid Regions Environmental and Engineering Institute, Chinese Academy of Sciences,Lanzhou 730000, China | |
| + | *National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan | ||
| + | *Institute of Plant Science and Resources, Okayama University, Kurashiki 710-0046, Japan | ||
| + | *Department of Plant Molecular Biology, University of Lausanne, CH-1015 Lausanne, Switzerland | ||
| + | *Shaanxi Key Laboratory of Molecular Biology for Agriculture, College of Agronomy, Northwest Agriculture and Forestry University, Yangling 712100, China | ||
| + | *Institute of Evolution, University of Haifa, Mount Carmel, Haifa 31905, Israel | ||
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | GuoXiong C, Pourkheirandish M, Sameri M, et al. Genetic targeting of candidate genes for drought sensitive gene eibi1 of wild barley (Hordeum spontaneum)[C]//Breeding science. Japanese Society of Breeding, 2009, 59(5): 637-644. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Chen G, Komatsuda T, Ma J F, et al. An ATP-binding cassette subfamily G full transporter is essential for the retention of leaf water in both wild barley and rice[J]. Proceedings of the National Academy of Sciences, 2011, 108(30): 12354-12359. | ||
| + | </ref> | ||
| + | * <ref name="ref3"> | ||
| + | Tanaka T, Tanaka H, Machida C, et al. A new method for rapid visualization of defects in leaf cuticle reveals five intrinsic patterns of surface defects in Arabidopsis[J]. The Plant Journal, 2004, 37(1): 139-146. | ||
| + | </ref> | ||
| + | * <ref name="ref4"> | ||
| + | Bessire M, Chassot C, Jacquat A C, et al. A permeable cuticle in Arabidopsis leads to a strong resistance to Botrytis cinerea[J]. The EMBO Journal, 2007, 26(8): 2158-2168. | ||
| + | </ref> | ||
| + | * <ref name="ref5"> | ||
| + | Kang J, Hwang J U, Lee M, et al. PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid[J]. Proceedings of the National Academy of sciences, 2010, 107(5): 2355-2360. | ||
| + | </ref> | ||
| + | * <ref name="ref6"> | ||
| + | Pighin J A, Zheng H, Balakshin L J, et al. Plant cuticular lipid export requires an ABC transporter[J]. Science, 2004, 306(5696): 702-704. | ||
| + | </ref> | ||
| + | * <ref name="ref7"> | ||
| + | Verrier P J, Bird D, Burla B, et al. Plant ABC proteins–a unified nomenclature and updated inventory[J]. Trends in plant science, 2008, 13(4): 151-159. | ||
| + | </ref> | ||
| + | * <ref name="ref8"> | ||
| + | Kim D Y, Bovet L, Maeshima M, et al. The ABC transporter AtPDR8 is a cadmium extrusion pump conferring heavy metal resistance[J]. The Plant Journal, 2007, 50(2): 207-218. | ||
| + | </ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 09:04, 5 February 2015
As a member of ABC subfamily G (ABCG), OsABCG31 is essential for the retention of leaf water[1][2].
Contents
Annotated Information
Function
- The Os01g0177900 gene product is an ABC-2 type transporter domain containing protein, predicted to participate in the transport of secondary metabolites. It is involved in various plant-pathogen interactions, and may also contribute to the transport of signalling molecules and the secretion of volatiles[1].
- One of these 10 genes encoded an OsABCG31 transporter and so was taken as the candidate for Eibi1. The sequence of the wild-type and mutant alleles revealed a single nucleotide difference in exon 14, predicted to alter a tryptophan codon into a TAG stop codon and thereby inducing a probable loss of function[2].
- Characterization of both barley and rice alleles indicated that the ABCG31 gene encoding a full ABCG transporter is involved in the formation of a functional cuticle. EIBI1 and its rice ortholog OsABCG31 may play additional roles in plant development[2].
Mutation
- osabcg31.b
- osabcg31.c
- Two independent transposon Oryza sativa 17 (Tos17) events within OsABCG31 (osabcg31.b and osabcg31.c) were identified (Fig. 1 E–G), and the association between genotype and leaf water retention was tested.
- Loss-of-function mutants in both wild barley and rice are less able to retain leaf water than their respective wild types. However, shoot development was compromised much more heavily in the rice mutants than in wild barley mutants. The rice mutants attained a plant height of just 3–8 cm and did not develop beyond the four- to five-leaf stage; whereas the two barley mutants attained a height of about two-thirds that of the wild type and were able to complete their life cycle through to maturity[2].
Expression
- The two mutants were both highly sensitive to drought stress (as represented by osabcg31.b in Fig. 2 H), and their leaves, along with those of the two wild barley eibi1 mutants, were readily stained by toluidine blue, similar to Arabidopsis plants having defective cuticle[2][3][4].
- Leaf permeability is much more increased in hvabcg31 and osabcg31 than in atabcg32, indicating the importance of ABCG31 in monocot leaf water retention[2].
Evolution
- The sequences of the wheat ESTs CJ579262, CD887967 and CD902914 share homology with the rice sequences Os01g0177900, Os01g0177200 and Os01g0176500, respectively[1].
- Homologs of EIBI1 were found in rice(OsABCG31), Arabidopsis(AtABCG32), Selaginella moellendorffii (Smo412699), Physcomitrella patens(Pp1s375_5V6.1), and Volvox carteri (Vca 40167). The monocot rice and the dicot Arabidopsis shared 92% and 71% sequence identities with EIBI1, respectively, indicating the conservation of EIBI1 in monocot and dicot plants(Figure 2)[2].
Knowledge Extension
Members of the diverse and ubiquitous family of ATP-binding cassette (ABC) proteins are involved in the transmembrane transport of various molecules[5][6]. ABC subfamily G (ABCG) includes both white-brown complex (WBC) half transporters and pleiotropic drug resistance (PDR) full transporters[7]. ABCG full transporters are thought to be specific to plants and fungi, where they participate in defense against pathogens and in resistance to cadmium, antimicrobial terpenoids, and auxinic compounds[2][8].
Labs working on this gene
- Laboratory of Plant Stress Ecophysiology and Biotechnology, Cold and Arid Regions Environmental and Engineering Institute, Chinese Academy of Sciences,Lanzhou 730000, China
- National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan
- Institute of Plant Science and Resources, Okayama University, Kurashiki 710-0046, Japan
- Department of Plant Molecular Biology, University of Lausanne, CH-1015 Lausanne, Switzerland
- Shaanxi Key Laboratory of Molecular Biology for Agriculture, College of Agronomy, Northwest Agriculture and Forestry University, Yangling 712100, China
- Institute of Evolution, University of Haifa, Mount Carmel, Haifa 31905, Israel
References
- ↑ 1.0 1.1 1.2 GuoXiong C, Pourkheirandish M, Sameri M, et al. Genetic targeting of candidate genes for drought sensitive gene eibi1 of wild barley (Hordeum spontaneum)[C]//Breeding science. Japanese Society of Breeding, 2009, 59(5): 637-644.
- ↑ 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 Chen G, Komatsuda T, Ma J F, et al. An ATP-binding cassette subfamily G full transporter is essential for the retention of leaf water in both wild barley and rice[J]. Proceedings of the National Academy of Sciences, 2011, 108(30): 12354-12359.
- ↑ Tanaka T, Tanaka H, Machida C, et al. A new method for rapid visualization of defects in leaf cuticle reveals five intrinsic patterns of surface defects in Arabidopsis[J]. The Plant Journal, 2004, 37(1): 139-146.
- ↑ Bessire M, Chassot C, Jacquat A C, et al. A permeable cuticle in Arabidopsis leads to a strong resistance to Botrytis cinerea[J]. The EMBO Journal, 2007, 26(8): 2158-2168.
- ↑ Kang J, Hwang J U, Lee M, et al. PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid[J]. Proceedings of the National Academy of sciences, 2010, 107(5): 2355-2360.
- ↑ Pighin J A, Zheng H, Balakshin L J, et al. Plant cuticular lipid export requires an ABC transporter[J]. Science, 2004, 306(5696): 702-704.
- ↑ Verrier P J, Bird D, Burla B, et al. Plant ABC proteins–a unified nomenclature and updated inventory[J]. Trends in plant science, 2008, 13(4): 151-159.
- ↑ Kim D Y, Bovet L, Maeshima M, et al. The ABC transporter AtPDR8 is a cadmium extrusion pump conferring heavy metal resistance[J]. The Plant Journal, 2007, 50(2): 207-218.
Structured Information
| Gene Name |
Os01g0177900 |
|---|---|
| Description |
ABC-2 type transporter domain containing protein |
| Version |
NM_001048722.1 GI:115434857 GeneID:4323865 |
| Length |
2275 bp |
| Definition |
Oryza sativa Japonica Group Os01g0177900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:4032949..4035223 |
| Sequence Coding Region |
4033077..4033349,4034007..4034261,4034362..4034533,4034616..4034843,4034922..4035055 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:4032949..4035223 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:4032949..4035223 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atatatgctggtcccttgggctcgaaatcacgcaatctggtcgagttttttgaggcaattccaggagttcctaaaatcagggatggctataatcctgctgcatggatgttggaagtcacaagtactcaaatggagcaaattcttggagtggattttgctgaatactaccggcagtcaaaattatttcagcagacccaagaaatggttgatatcctgagcagaccaagaagagaatcaaaagaacttacttttgccaccaagtattcccaaccattctttgctcaatatgctgcttgcttatggaagcagaacctgtcgtactggagaaatcctcaatacactgcggtccgattcttctacaccgtcatcatttccttgatgttcgggacaatctgctggaaatttgggtctcgaagggagacccaacatgacatattcaatgccatgggtgccatgtacgcagcagtactcttcataggaatcactaacgccacctctgttcaacctgtgatttccatcgaaagatttgtctcgtacagagagagggcagctgggatgtactcggcactgccttttgcattctccctggttacagtggagttcccttacattcttgtgcagtcacttatctacggcacgattttctacagcttgggctcgttcgagtggacagcagtgaagttcttgtggtacctgttcttcatgtacttcaccttgctgtacttcactttctatggcatgatgacaacggcgatcactcccaaccacactgttgcgcctattattgctgctccattctacacgctgtggaatctcttctgtgggttcatgatcccaagaaagaggattcctgcgtggtggaggtggtattactgggccaacccggtgtcatggaccctgtacggcctgctaacctcccagttcggcgacctggatcagccgctgctgctcgccgacggcatcaccaccaccaccgccgtcgacttcctccgggaccacttcggcttccgccacgacttcctcggcgtcgtcgccggcatggtcgccggcttctgcgtgctcttcgccgtcgtcttcgccctggccatcaagtacctcaacttccagagaagatga</cdnaseq> |
| Protein Sequence |
<aaseq>IYAGPLGSKSRNLVEFFEAIPGVPKIRDGYNPAAWMLEVTSTQM EQILGVDFAEYYRQSKLFQQTQEMVDILSRPRRESKELTFATKYSQPFFAQYAACLWK QNLSYWRNPQYTAVRFFYTVIISLMFGTICWKFGSRRETQHDIFNAMGAMYAAVLFIG ITNATSVQPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYILVQSLIYGTIFYSL GSFEWTAVKFLWYLFFMYFTLLYFTFYGMMTTAITPNHTVAPIIAAPFYTLWNLFCGF MIPRKRIPAWWRWYYWANPVSWTLYGLLTSQFGDLDQPLLLADGITTTTAVDFLRDHF GFRHDFLGVVAGMVAGFCVLFAVVFALAIKYLNFQRR</aaseq> |
| Gene Sequence |
<dnaseqindica>1875..2147#963..1217#691..862#381..608#169..302#3..56#ttatatatgctggtcccttgggctcgaaatcacgcaatctggtcgagttttttgaggtacaatctgcacaatgtgtttcctcagtgatgatagcttatacaagtttctctgtccttacactttgcgttcgcgaaaaaactgtccttacactttcaagtttgtaaacaggcaattccaggagttcctaaaatcagggatggctataatcctgctgcatggatgttggaagtcacaagtactcaaatggagcaaattcttggagtggattttgctgaatactaccggcagtcaaaattatttcagtaaacacaacgacccttttcacctctataaatcttggtctctttttccttaaacatgtttatgttatggcattccaggcagacccaagaaatggttgatatcctgagcagaccaagaagagaatcaaaagaacttacttttgccaccaagtattcccaaccattctttgctcaatatgctgcttgcttatggaagcagaacctgtcgtactggagaaatcctcaatacactgcggtccgattcttctacaccgtcatcatttccttgatgttcgggacaatctgctggaaatttgggtctcgaaggtatgtccactgatgattctgtctccacttttcttcctgtacttggctggccttatagcgaacatgtggctttgtttgacagggagacccaacatgacatattcaatgccatgggtgccatgtacgcagcagtactcttcataggaatcactaacgccacctctgttcaacctgtgatttccatcgaaagatttgtctcgtacagagagagggcagctgggatgtactcggcactgccttttgcattctccctggtaattttccctgtcaaaaactcctgtcatctcatcatgttttgatgctcgtagtagtaccataataaggctaacaatcgaactgttcttcggcatgcaggttacagtggagttcccttacattcttgtgcagtcacttatctacggcacgattttctacagcttgggctcgttcgagtggacagcagtgaagttcttgtggtacctgttcttcatgtacttcaccttgctgtacttcactttctatggcatgatgacaacggcgatcactcccaaccacactgttgcgcctattattgctgctccattctacacgctgtggaatctcttctgtgggttcatgatcccaagaaaggtacggaaggaacaggaaccccatgcataatttgcacctaacgtcctctaattgtactggacccatgatctgttttccccataatccatattccagtgcacattatccatatctttattttttttgtcacattagcatatatagctatggaaatagtgtttccaatccataaggccacttccagtgcacattatccatatctttatttttttttgtcacattaacatatatagctatggaaatagtgtttccaatgcatattatttattactggggccaaaaatgaattatctcccttcgcaaatttcatcagaaattcttagaggagatatctattttcctggtttgaatatatatgcaatgtctcatccgagacactcttttttctttataattccttagcacatcatctaaaatgctgctatgttgcatagtagtttttagtttctattaacattgtactataatggagcatgagtgccctgatataccagtgcccctaataatttcaccaaacccaccagtaactttttttgtcctacagtgaccacttgtcatgtactagaaccactttagcaattgggaagcaataatggtttgtttaaattaggacgtgattaaagtggctaatgattaatgggcttaaacataatgcagaggattcctgcgtggtggaggtggtattactgggccaacccggtgtcatggaccctgtacggcctgctaacctcccagttcggcgacctggatcagccgctgctgctcgccgacggcatcaccaccaccaccgccgtcgacttcctccgggaccacttcggcttccgccacgacttcctcggcgtcgtcgccggcatggtcgccggcttctgcgtgctcttcgccgtcgtcttcgccctggccatcaagtacctcaacttccagagaagatgagacgacgacgagcgagaagcgagctatagggagcacgacgtacaccaccattaattctctggccagctatagcgctcaaatgtgtactgcaactactatgcatgcatcaatccatttcgtttcttcag</dnaseqindica> |
| External Link(s) |