Difference between revisions of "Os02g0178800"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
'''''OsGL1-2''''' is a member of the '''GL1-like genes''' in rice<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*The full-length cDNA of ''OsGL1-2'' was isolated from Minghui 63 by gene-specific primers and '''cloned''' into pCAMBIA1301S under the control of Cauliflower mosaic virus 35S promoter<ref name="ref1"/>.
 +
 
 +
*''OsGL1-2'' gene has a significant role in '''controlling the wax layer''' and thus '''protecting leaves''' from '''water loss''' in rice<ref name="ref1"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]
 +
 
 +
===Mutation===
 +
*Among '''23''' independent transgenic plants generated, '''nine''' transgenic plants showed high expression level of the transgene<ref name="ref1"/>.
 +
 
 +
*Compared to the over-expression and wild type plants, the ''osgl1-2'' mutant was more '''sensitive''' to '''drought stress''' at '''reproductive stage''', suggesting an important role of this gene in '''drought resistance'''<ref name="ref1"/>.
 +
 
 +
*The crystallization patterns of cuticular waxes on matured leaves of the osgl1-2 mutant were significantly different and reduced compared to OsGL1-2 overexpression and WT plants<ref name="ref1"/>.
 +
 
 +
*The ''osgl1-2'' mutant showed rapid water loss and decreased epidermal permeability compared to the ''OsGL1-2'' over-expression and WT plants, suggesting that the mutant plants may be susceptible to drought<ref name="ref1"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*Compared to the wild type, the ''OsGL1-2''-over-expression rice '''exhibited more wax crystallization''' and '''a thicker epicuticular layer'''; while the mutant of this gene showed '''less''' wax crystallization and a '''thinner''' cuticular layer<ref name="ref1"/>.
 +
 
 +
*The expression levels of ''OsGL1-1'' and ''OsGL1-2'' were gradually '''increased''' throughout the '''time course''', whereas the ''OsGL1-6'' showed strong induction only at 2 day after treatment<ref name="ref1"/>.
 +
 
 +
*''OsGL1-2'' was '''induced''' by '''ABA treatment''', and the highest induction was at 12 h after the treatment. RT-PCR analysis showed that the transcript of ''OsGL1-2'' gene was '''broken down''' in the 04Z11ML82 mutant<ref name="ref1"/>.
 +
 
 +
*The ''OsGL1-2''-overexpresion plants showed a significant '''decrease''' of chlorophyll leaching and the ''osgl1-2'' mutant plants showed a significant increase of chlorophyll leaching, which indicates that over-expression of ''OsGL1-2'' genes '''decreased the cuticular permeability''' and '''perhaps''' can cause '''drought tolerance''' of the plants<ref name="ref1"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
'''GL1''' shows high sequence similarity with OsGL1-1(76%), OsGL1-2 ('''62%'''), and OsGL1-3 (62%), suggesting that the OsGL1-1~3 may be '''homologs of GL1'''<ref name="ref1"/>.
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
*The outermost surfaces of plants are covered with an epicuticular wax layer that provides a primary waterproof barrier and protection against different environmental stresses. '''Glossy 1''' (GL1) is one of the reported genes '''controlling wax synthesis'''<ref name="ref1"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, 430070 Wuhan, China
 +
*Department of Genetic Engineering and Biotechnology, University of Rajshahi, Rajshahi 6205, Bangladesh
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Islam M A, Du H, Ning J, et al. Characterization of Glossy1-homologous genes in rice involved in leaf wax accumulation and drought resistance[J]. Plant molecular biology, 2009, 70(4): 443-456.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 12:14, 27 February 2015

OsGL1-2 is a member of the GL1-like genes in rice[1].

Annotated Information

Function

  • The full-length cDNA of OsGL1-2 was isolated from Minghui 63 by gene-specific primers and cloned into pCAMBIA1301S under the control of Cauliflower mosaic virus 35S promoter[1].
  • OsGL1-2 gene has a significant role in controlling the wax layer and thus protecting leaves from water loss in rice[1].


GO assignment(s): GO:0003824,GO:0008152

Mutation

  • Among 23 independent transgenic plants generated, nine transgenic plants showed high expression level of the transgene[1].
  • Compared to the over-expression and wild type plants, the osgl1-2 mutant was more sensitive to drought stress at reproductive stage, suggesting an important role of this gene in drought resistance[1].
  • The crystallization patterns of cuticular waxes on matured leaves of the osgl1-2 mutant were significantly different and reduced compared to OsGL1-2 overexpression and WT plants[1].
  • The osgl1-2 mutant showed rapid water loss and decreased epidermal permeability compared to the OsGL1-2 over-expression and WT plants, suggesting that the mutant plants may be susceptible to drought[1].

Expression

  • Compared to the wild type, the OsGL1-2-over-expression rice exhibited more wax crystallization and a thicker epicuticular layer; while the mutant of this gene showed less wax crystallization and a thinner cuticular layer[1].
  • The expression levels of OsGL1-1 and OsGL1-2 were gradually increased throughout the time course, whereas the OsGL1-6 showed strong induction only at 2 day after treatment[1].
  • OsGL1-2 was induced by ABA treatment, and the highest induction was at 12 h after the treatment. RT-PCR analysis showed that the transcript of OsGL1-2 gene was broken down in the 04Z11ML82 mutant[1].
  • The OsGL1-2-overexpresion plants showed a significant decrease of chlorophyll leaching and the osgl1-2 mutant plants showed a significant increase of chlorophyll leaching, which indicates that over-expression of OsGL1-2 genes decreased the cuticular permeability and perhaps can cause drought tolerance of the plants[1].

Evolution

GL1 shows high sequence similarity with OsGL1-1(76%), OsGL1-2 (62%), and OsGL1-3 (62%), suggesting that the OsGL1-1~3 may be homologs of GL1[1].

Knowledge Extension

  • The outermost surfaces of plants are covered with an epicuticular wax layer that provides a primary waterproof barrier and protection against different environmental stresses. Glossy 1 (GL1) is one of the reported genes controlling wax synthesis[1].

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, 430070 Wuhan, China
  • Department of Genetic Engineering and Biotechnology, University of Rajshahi, Rajshahi 6205, Bangladesh

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Islam M A, Du H, Ning J, et al. Characterization of Glossy1-homologous genes in rice involved in leaf wax accumulation and drought resistance[J]. Plant molecular biology, 2009, 70(4): 443-456.

Structured Information

Gene Name

Os02g0178800

Description

Similar to Glossy1 protein

Version

NM_001052615.1 GI:115444600 GeneID:4328496

Length

7316 bp

Definition

Oryza sativa Japonica Group Os02g0178800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:4355070..4362385

Sequence Coding Region

4355207..4355362,4355574..4355747,4356234..4356344,4356506..4356712,4357609..4357716
,4358442..4358698,4359120..4359241,4359782..4360001,4360877..4361130
,4361782..4362005,4362136..4362189

Expression

GEO Profiles:Os02g0178800

Genome Context

<gbrowseImage1> name=NC_008395:4355070..4362385 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:4355070..4362385 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctgctcctcctctctcgtcgtggccatgggcaagcctcggctcgtacaagtatgtgttgtacggggcggtggtgtggaaggtggcggaggagtggaggcagcaaggggcggcgccggtggggtcgtggtggctccacctgctgctgctgttcgccgcccgcgggctcacctaccagttctggttctcctacggcaacatgctcttcttcacccgccgccgccgcgtcgtccccgactccgtcgacttccgccaggtcgacgccgaatgggactgggataactttctgctgctgcagacgctgataggggcaacgttggtggggagcccggcggtggcgcggcagcagctgctgctcccaagcctgaagcaagcgtgggacccacgcgggtgggccatcgcactgctgctgcatgtgttggtcgctgagccgctcttttactgggcccaccgggccctgcaccgggccccactcttcagccgctaccacgccgctcaccaccacgcctcggtcaccacacccttgacagctggatttgggacgccactggagagcctgctgctgacggtggtgataggggtcccactcgcaggggcctttctgatgggggtagggtccgtgggcctggtctatggacacgtccttttgtttgacttcttgaggtccatgggctacagtaacgtggaggtgatatcccctagggtcttccaggctgttcctcttctcagatacctcatctacacccctacgtacctgagcctgcaccacagggagaaggactcaaacttctgcctgttcatgcctatttttgatctcctggggggcaccctcaaccacaagtcatgggagctgcaaaaggaggtctacttaggcaagaacgatcaggcgccggacttcgtgttcctggcacacgtggtggacatcatggcgtcgatgcacgtgccgttcgtgctccggtcgtgcagctcgacgccgttcgccaaccacttcgtcctcctcccgttttggccggtcgccttcggcttcatgctgctcatgtggtgctgctccaagaccttcctcgtcagctcctaccgcctccgcggcaacctccaccagatgtggactgtcccccgatatgggtttcagtacttcataccggcggcgaagaaaggcatcaacgagcagatcgagctggccatcctgcgtgcagatcggatgggcgtcaaggtgctcagcctcgccgctctcaataagaacgaggcactgaatggaggtggcacgctgttcgtgaacaagcacccggagctgagggtgagggtggtgcacggcaacaccctgacggcggccgtgatcctcaacgagatccccagcaacgtcaaggacgtcttcctcaccggcgccacctccaagctcggcagagccatcgccctctacctctgcagaaaaaagatcagagtcctgatgttgacattgtcgtcggagaggtttctgaagattcagagggaagcaccggcagagttccagcagtacctcgtgcaggtcaccaagtaccagcctgcacaaaactgcaagacgtggctggtggggaagtggctgtcgccgagggagcagaggtgggcgccggcggggacacacttccaccagttcgtggtgccgccgatcatcgggttccggcgagactgcacctacggcaagctcgccgccatgaggctccccaaggacgtccagggcctcggctactgcgagtacacgatggaacgcggggtggtgcacgcgtgccacgccggcggcgtggtgcacttcctggaagggtgggagcaccacgaggtgggcgccatcgacgtcgaccggatcgacgtcgtctggaaggcggcgctcaagcacggcctcacgccggcgtga</cdnaseq>

Protein Sequence

<aaseq>MAAPPLSSWPWASLGSYKYVLYGAVVWKVAEEWRQQGAAPVGSW WLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVPDSVDFRQVDAEWDWDNFLLLQTL IGATLVGSPAVARQQLLLPSLKQAWDPRGWAIALLLHVLVAEPLFYWAHRALHRAPLF SRYHAAHHHASVTTPLTAGFGTPLESLLLTVVIGVPLAGAFLMGVGSVGLVYGHVLLF DFLRSMGYSNVEVISPRVFQAVPLLRYLIYTPTYLSLHHREKDSNFCLFMPIFDLLGG TLNHKSWELQKEVYLGKNDQAPDFVFLAHVVDIMASMHVPFVLRSCSSTPFANHFVLL PFWPVAFGFMLLMWCCSKTFLVSSYRLRGNLHQMWTVPRYGFQYFIPAAKKGINEQIE LAILRADRMGVKVLSLAALNKNEALNGGGTLFVNKHPELRVRVVHGNTLTAAVILNEI PSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTLSSERFLKIQREAPAEFQQYLVQ VTKYQPAQNCKTWLVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL PKDVQGLGYCEYTMERGVVHACHAGGVVHFLEGWEHHEVGAIDVDRIDVVWKAALKHG LTPA</aaseq>

Gene Sequence

<dnaseqindica>7024..7179#6639..6812#6042..6152#5674..5880#4670..4777#3688..3944#3145..3266#2385..2604#1256..1509#381..604#197..250#ggatctcttcttataagtagagagggagacgcagcgtgtggcatccaaagctctctctctctctctctcatagctagctagagcatgcagctactagctagcaagcttaattagcagccacacattagagtcacaaagtgagagagaaggaggagcttcacaagctcgatcgagagagcaaactaagcaagcagccatggctgctcctcctctctcgtcgtggccatgggcaagcctcggctcgtacaaggcatgcatataatctctctcttaagtcgtcaattaatctctctttgttagtttcttcttcttcttcttcttcttctaccttattaagctaattaacgtgtgcgtggttaattaatgggagatgggtgcagtatgtgttgtacggggcggtggtgtggaaggtggcggaggagtggaggcagcaaggggcggcgccggtggggtcgtggtggctccacctgctgctgctgttcgccgcccgcgggctcacctaccagttctggttctcctacggcaacatgctcttcttcacccgccgccgccgcgtcgtccccgactccgtcgacttccgccaggtcgacgccgaatgggactggtacgcccttcgccgtctctctctctatctatctcattctcctccgccgtagctagctagtcgccggccggtcgccgacggcgtgcatttgtgtcctattcatttttagattgatttttttgagagggagaaaatatggctttgcatccaaggcaagcagtggtcaccaagcccagagacagtactgtaccatccagtcatccactgttagatcagatcccagcttcagccttcagaagagttcagacagacagacgccatggctgctctcttatctagaatcatcgtaattactactcatatatgtcaccatttctactgcttaaaccagcaccagcagtaaaattaagaatgaatctgttttatgtagacctccctccctcaatcctaaaataactataagtatagttttatactgtccttatctaacgtttgaccgttcgtcttatttaattttttaattatttttatttattagatgataaaacatgaatattactttatatgtgactaattattttataaaatttttaaataatacgaacggttaaatgttagaaacggatatccacggcaacacttatttttagaatggaggtagcaatatgtgtttttctttttttgatgggattattttgcatatatatgcagggataactttctgctgctgcagacgctgataggggcaacgttggtggggagcccggcggtggcgcggcagcagctgctgctcccaagcctgaagcaagcgtgggacccacgcgggtgggccatcgcactgctgctgcatgtgttggtcgctgagccgctcttttactgggcccaccgggccctgcaccgggccccactcttcagccgctaccacgccgctcaccaccacgcctcggtcaccacacccttgacaggtactctacacctgtactcatcatgtactgtactccataccatactccccaacaaagtttaggagtataaaaagggagtgtatttattcctatctatgaactgtttggtgtaccaaatttgttttgaaaattctcgttggaactgtgaaccagtttatgtatgatgttttgttgtcttaatgagttgcagcagatattttgaaacttaatgttggttttgggatagattttgaagtgttttatttgtcgtagtttgttttttctagcattgacttttaaacaataaacaataaaaatataaaatgttatgcatagattattcttttttctgcttcattcatactccctccgtattttaatgtgtgacgccgttgacttttcgactaacgtttgaccattcattttattcaaaattttcgtgcaaatatgaaaatatttatatcatgcttaaataacatttgatgatgaatctagtcacaataaaataaatgacaattgcataaattttttttaataagacgaatggtcaaacgttggataaaaagtcaactgcgtcatacattaaaatatggagctagtatttctacattgattaacccatcagagtggtacaatttatgaagattaaattaatcgagactagcctgaaattttaattttaaaacgtaattatgaagttgattttaagtttttttaatcgtgatccatattttagcaagatttttttatatatattttagcattgtagatataaatattttatctataatttatttttaattatacgtctcatacggttatacggttatagcgttgtaggagtacaattttgactggctgatgataagcttttcctgtgttacgttggtctgcagctggatttgggacgccactggagagcctgctgctgacggtggtgataggggtcccactcgcaggggcctttctgatgggggtagggtccgtgggcctggtctatggacacgtccttttgtttgacttcttgaggtccatgggctacagtaacgtggaggtgatatcccctagggtcttccaggctgttcctcttctcagatacctcatctacacccctacgtgagtgcaaaaataaaataatagtataatgtatttgttttctgataaatacttctctattcataacttttggtaaattggattgaaaattattttagttgaccaccgatatcttgtaaatcgtttgattcaattaatgggaactatatgcttatattttttaatagctaccagtttatttttaaaataggagtgatcggactaaaacaatgcaaggtcaaaattatcaagtattgtaaaatggagaaaataagtaaattatttttgtctaagacagttagttaaataaataaataactactttataaggttgagatacaagtagtactaattatgctgcacttcattgtatggaccgtgctgctatctgcttaattgcatctgtcatttggtcactatcctagtgttgttagctgtactgctaattggttgttagagaaaagttgattaattagtcggtgttgtatgaagaggtgatacaagtaattaaaatcgatttgattgttctaatgcattatgcatatggatttaattgcgcaggtacctgagcctgcaccacagggagaaggactcaaacttctgcctgttcatgcctatttttgatctcctggggggcaccctcaaccacaagtcatgggagctgcaaaaggaggtctacttaggtagggtgcacgcctaattagtgcattttattatgccttttgcttcaagaaacaagaattatattcagtcagtgtgctacaagacccataagaaacattaacatttggaattgattcctgcaaaattcccaagccccaaaaatcttgaagattttttacaattaaaacaaagagatttggagggagagacattgctccagacattaacatttagaattaattcatgcaaaattcccaagccccaaaaatcttgaatatttttacaataaaaaaacttttttaaagaagaaattatgagcgtgcggggattgaacacatgacctcaagggttgaaatcacacatctattatcatttcactatcgagagcttgacggttttataataatattatttcgcgaaaaatggcaattgttgatgtaggcaagaacgatcaggcgccggacttcgtgttcctggcacacgtggtggacatcatggcgtcgatgcacgtgccgttcgtgctccggtcgtgcagctcgacgccgttcgccaaccacttcgtcctcctcccgttttggccggtcgccttcggcttcatgctgctcatgtggtgctgctccaagaccttcctcgtcagctcctaccgcctccgcggcaacctccaccagatgtggactgtcccccgatatgggtttcaggtataatcacaataacccccccccccccccctctctcttctcgcctagcttaattccagaataatttaaaattatatcatatctcatgtcggtataacatgagacaatattttagaattagtatgtgatctcaccgtaaatttttcaccccgtcacatcgaacgtctaaagacatgcatgaagtattaaatatatgcttaaaaaataactaattgcataaattgcgactaatttgcaagacagatcatttaagcctaattgctccatgatttgataatgtggtgctacagtaaatatgtgctaatgacagattaattaggcttaataaatttgtctcgtagtttactgacggattttgtaattattttttttattagtgcccgaacaccccatacgacacactatataatacccgatgtgacacaccaaaactttacacccatgaatttaaacactctcgtactgactgtatcgagaggacaactgagatatcatggatggatcataggttgtccatcaattaattggtagaggtgttgtggtaccatactattcaatggcacctctctcgcaagtacttgtacagtacagtagtgacaacagtggttaatgtgtggctttaactttgcagtccctatagaaaactgcatgtgattcggttttgtgtaggccatctgaacttgtgaattgattctgacattggcgccatgtatgcaaattcacagtacttcataccggcggcgaagaaaggcatcaacgagcagatcgagctggccatcctgcgtgcagatcggatgggcgtcaaggtgctcagcctcgccgctctcaataaggtcagttgttttacaaaagatctggttcgtttcagctttttttttcgattattatcacgaattatttatttatttatttattcatgtcaccaagaatacattttttaaatatttatttattaaaacatttaatttatgtatataatcatatagataatccgttacaataatagtccaataatttatgtatatttaatatttgctacctgtacatgtcttgtctcttccatgcctcaacttttttttccttttcctttatcactttcttgcaatgacacagacacgtacatgtctctttctttgatcataatgtgccgtgttatgcatatagttgagcagtattggatatacagcatgtataataagatacttgtccattaactagtacagtatcactgctgatgattcagtaggggtgttctgtttttcctcatctttcttcaactttctccctgtcattttcaaaagaaaaaaaaggaaaaaaaagagagtatgtgatgttcatgtcagtctctttgctgttcatgtgtcgcccatacagttgggcagcattggttatctagcacagactaccggaaccaattcatcatcatttatgatgggcatgtgaaatccttaactgattcaacgttgaaatggcggcgaagatggaaatgcgaccgtgacgcgtgtaatcggagtagatgcagcggtggctagctcataactaaaaaatctgcgttcattgttcagacagttaaaaagttcaggaatttcatctgatcagcactgtaaacagaatctttaggctagcaatctagcattactcaaaaatcaaaatgcagtgcaacgatctgatcttaactgaaactctttgaatcttcttatgttttggtttggtttcttgtttctgtcagaacgaggcactgaatggaggtggcacgctgttcgtgaacaagcacccggagctgagggtgagggtggtgcacggcaacaccctgacggcggccgtgatcctcaacgagatccccagcaacgtcaaggacgtcttcctcaccggcgccacctccaagctcggcagagccatcgccctctacctctgcagaaaaaagatcagagtcctggttcgtgctctgctgcctgtctgaactctgaactgaaccccaaaaaaggagaaaaaaaactctgtgttaattcacagcatgattagatgagtatgttaaacaagaggatgattgcaagactgggattgatggttctgtgtgctaatcttttttggttttagatgttgacattgtcgtcggagaggtttctgaagattcagagggaagcaccggcagagttccagcagtacctcgtgcaggtcaccaagtaccagcctgcacaaaactgcaaggtaattcactcgctggaatttcaataagtttcagtaattcaaggctgtgtccatgatgtgattgtccacattttctttcatcaggttttatccaccaaccagttaacctataaaacatagacttttgtcagagtcatattgtcccgctgaccaattaacccagaaaaagttacattttttgtctcagttgtatgcaccgaccagatcaccaaaagtttactttagtgtttattttgggtctagctatatttatggcgccaagttgtatgcactagctagttcgacggaaaagcttagggtaattttaccatctaagaaggtacccgaaagttaccgtattttctgatgtaaaatttagtacttccgaatactaggtatctcaagatagtaaatttttttaatgtaagatttaagtatcccgggttactttttcaaataccgtaaaatttatcagaagctaaagttggatggatggcattgttgcagacgtggctggtggggaagtggctgtcgccgagggagcagaggtgggcgccggcggggacacacttccaccagttcgtggtgccgccgatcatcgggttccggcgagactgcacctacggcaagctcgccgccatgaggctccccaaggacgtccagggcctcggctactgcgaggtacttcctccgtttcatattacagtcactttaaacctttttttataacaaaactctttttagattcgactaaatttatagaaaaattttgtccattattattattattattattattattattattattattattattattattatattcttcttctccgagttcgctgacatggtcggccggcgatcgccgggaaacatatgtgtgcagtacacgatggaacgcggggtggtgcacgcgtgccacgccggcggcgtggtgcacttcctggaagggtgggagcaccacgaggtgggcgccatcgacgtcgaccggatcgacgtcgtctggaaggcggcgctcaagcacggcctcacgccggcgtgaccgccgccgccggaggccagcggcgaagccaacgagaacggccggcgatcttgtgggatttggtgtgctgtaagatagaagaaatgtacgagaaaaaaacgatttgccgtgggatttaaattaattaaaatttaatc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0178800, RefSeq:Os02g0178800