Difference between revisions of "Os02g0818000"
| Line 1: | Line 1: | ||
| − | + | '''''UIP1''''' (3'-UTR-interacting protein 1) acts as a chaperone protein of ''RbcS1'' transcripts by associating with the RbcS1 3'-UTR in an event of SMD leading them to either PBs or SGs<ref name="ref1"/>. | |
| − | |||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | The '''CBS domain''' of ''UIP1'' is necessary for '''binding to 3' ''RbcS'''''. ''UIP1'' interacts with 3' untranslated region of ''RbcS1'' mRNA and '''increases tolerance''' of transgenic overexpressors to '''drought stress'''<ref name="ref1"/>. | |
| + | |||
| + | ===Mutation=== | ||
| + | transgenic and nontransgenic (NT) control plants<ref name="ref1"/>: | ||
| + | *During drought stress conditions, NT plants started to show '''visual symptoms''' of drought-induced '''damage''' such as leaf rolling and wilting with a concomitant loss of chlorophylls at an earlier stage than the ''OsCc1:UIP1'' plants. | ||
| + | *Upon rewatering, transgenic plants '''recovered well''' compared to the NT plants. Consequently, NT plants remained severely affected by drought stress while transgenic lines partially recovered after 3 days of rewatering. | ||
| + | *The Fv/Fm values of the ''OsCc1:UIP1'' plants were '''higher''' than those of the NT plants under the time course of stress treatments. | ||
===Expression=== | ===Expression=== | ||
| − | + | *Transgenic overexpression of ''UIP1'' in rice resulted in an '''increase in tolerance to drought stress''' at the '''vegetative stage''' of growth. Under '''drought''', '''high salt''' and '''low temperature''' conditions, the maximum photochemical efficiency of photosystem II (Fv/Fm) of UIP1 plants was '''higher''' than those of the nontransgenic plants<ref name="ref1"/>. | |
| − | = | + | *Interestingly, the effect of ''UIP1'' overexpression on tolerance to stress was much '''more pronounced''' under drought than under high salt and low temperature conditions<ref name="ref1"/>. |
| − | |||
| − | + | ===Knowledge Extension=== | |
| + | The 3'RbcS is the major mRNA region involved in a phenomenon referred to as stress-induced mRNA decay (SMD) under drought and salt stress conditions. SMD was observed on the mRNAs of photosynthetic genes (e.g., RbcS1, Cab1, and PCY) that are rapidly degraded when | ||
| + | plants are exposed to stress<ref name="ref2"/>. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea | |
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | Park S H, Jeong J S, Redillas M C F R, et al. Transgenic overexpression of UIP1, an interactor of the 3′ untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought[J]. Plant biotechnology reports, 2013, 7(1): 83-90. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Park S H, Chung P J, Juntawong P, et al. Posttranscriptional control of photosynthetic mRNA decay under stress conditions requires 3′ and 5′ untranslated regions and correlates with differential polysome association in rice[J]. Plant physiology, 2012, 159(3): 1111-1124. | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 08:57, 1 March 2015
UIP1 (3'-UTR-interacting protein 1) acts as a chaperone protein of RbcS1 transcripts by associating with the RbcS1 3'-UTR in an event of SMD leading them to either PBs or SGs[1].
Contents
Annotated Information
Function
The CBS domain of UIP1 is necessary for binding to 3' RbcS. UIP1 interacts with 3' untranslated region of RbcS1 mRNA and increases tolerance of transgenic overexpressors to drought stress[1].
Mutation
transgenic and nontransgenic (NT) control plants[1]:
- During drought stress conditions, NT plants started to show visual symptoms of drought-induced damage such as leaf rolling and wilting with a concomitant loss of chlorophylls at an earlier stage than the OsCc1:UIP1 plants.
- Upon rewatering, transgenic plants recovered well compared to the NT plants. Consequently, NT plants remained severely affected by drought stress while transgenic lines partially recovered after 3 days of rewatering.
- The Fv/Fm values of the OsCc1:UIP1 plants were higher than those of the NT plants under the time course of stress treatments.
Expression
- Transgenic overexpression of UIP1 in rice resulted in an increase in tolerance to drought stress at the vegetative stage of growth. Under drought, high salt and low temperature conditions, the maximum photochemical efficiency of photosystem II (Fv/Fm) of UIP1 plants was higher than those of the nontransgenic plants[1].
- Interestingly, the effect of UIP1 overexpression on tolerance to stress was much more pronounced under drought than under high salt and low temperature conditions[1].
Knowledge Extension
The 3'RbcS is the major mRNA region involved in a phenomenon referred to as stress-induced mRNA decay (SMD) under drought and salt stress conditions. SMD was observed on the mRNAs of photosynthetic genes (e.g., RbcS1, Cab1, and PCY) that are rapidly degraded when plants are exposed to stress[2].
Labs working on this gene
- School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea
References
- ↑ 1.0 1.1 1.2 1.3 1.4 Park S H, Jeong J S, Redillas M C F R, et al. Transgenic overexpression of UIP1, an interactor of the 3′ untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought[J]. Plant biotechnology reports, 2013, 7(1): 83-90.
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref2
Structured Information
| Gene Name |
Os02g0818000 |
|---|---|
| Description |
CBS domain containing protein |
| Version |
NM_001055060.1 GI:115449676 GeneID:4331153 |
| Length |
2152 bp |
| Definition |
Oryza sativa Japonica Group Os02g0818000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:35978345..35980496 |
| Sequence Coding Region |
35979184..35979200,35979351..35979522,35979640..35979816,35979925..35979994,35980085..35980156 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:35978345..35980496 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:35978345..35980496 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>aggcctccggctacgatcttccggtgccgggcatcgacgttcatggacgggagcctccggctagagatcgacgagaaccctgaagccatcatctccggtgagtggccggagaacttctccctgctcagctacgacgatctccgcgcctacctccagtcacaggaggccgctgctcaagccgacaaccagcgtgtggcgctcctgagtgaagccatgtcggcgcctgtgctggtagccactgccgagcagacgctggaggaggttgagtgccactttgagacggtctcaggtctcccagttatagatgccagcctcagatgtgttggagtgatcgtcaagagtgaccgggccagggcttctcatgggtcaaagacgaagattgcagaagtgatgacctctccagccatcactctaccatctgacaaaacagtaatggatgcggcagctctgatgctaaagaagaagatccacagattaccaattgtaaatcaggacagacaagtgataggtatagttacccgtgctgacgttcttcgcgagttggaagccctgctggaggtttag</cdnaseq> |
| Protein Sequence |
<aaseq>RPPATIFRCRASTFMDGSLRLEIDENPEAIISGEWPENFSLLSY DDLRAYLQSQEAAAQADNQRVALLSEAMSAPVLVATAEQTLEEVECHFETVSGLPVID ASLRCVGVIVKSDRARASHGSKTKIAEVMTSPAITLPSDKTVMDAAALMLKKKIHRLP IVNQDRQVIGIVTRADVLRELEALLEV</aaseq> |
| Gene Sequence |
<dnaseqindica>840..856#1007..1178#1296..1472#1581..1650#1741..1812#1945..2000#cggccaagctcgactgcaagttcagcaagcaacttggcagatgcatacacagcatcgaagcatccaagatcgatcgcccacctaacacggcgagctatctgttttccagcggcgaaagaaaccacgggcacggcgagtcggctcaccggccggccggtcggtactcagtaccaaaccaaaggtcaggatgatccggcttatccactgccacgtgacctgggcccaagagaatcccgccagccaatcgccgcgcgccacgtcgcccgctctgtccctgtagaacacacaatcatgtccgaattccacgtcagtccacatccaaacttggagaaatctgagagaattactcacactaacctgacttcttcactgatgaatgcaacccatcgtacttggtagtagtagtacatatccatataaccatatcctgtttcaggccttgtcagtgacaccttggttaaaaccacccatgcaccattctgctgctctcaaatcactatcctgaatacactaatctcaatctaattactaagtttcagccaaacctcagaatatgcaaaatagtcatcttcagcttgcaatttgcagatccataagttttgccatatgcatggactatgataaatgccacctctgaatctctgatagcagaaacaaatgatgatgagatactaacaagcactaatggagtattaaaaaagatctgagcatggatgaggtcaaagtccaccaataggatctgagcagtagcagtcattggtgggccagcacctcccatgcattcctatccacctcagctccctgacaatagacgcaagtatccagttcactataaatgaaggcctccggctacgatctgcaggagaaaaaacagtcagaagctaaggaagaaaaagtatagacacagtgatacaatggcctgcatcaacacattccagagctgctccgtcctcaagggagcaaagatcaatggtaccaagatcggaggagggaggggatcaccaaccttccggtgccgggcatcgacgttcatggacgggagcctccggctagagatcgacgagaaccctgaagccatcatctccggtgagtggccggagaacttctccctgctcagctacgacgatctccgcgcctacctccagtcacaggaggccgctgctcaagccgacaaccaggtgcactgatcacaccatatatacatagattcttcttcttcagatcaccaactgtcgatcttcttcttaagatcttgctaaactctgaactggttgcatggttggtgaattgaccagcgtgtggcgctcctgagtgaagccatgtcggcgcctgtgctggtagccactgccgagcagacgctggaggaggttgagtgccactttgagacggtctcaggtctcccagttatagatgccagcctcagatgtgttggagtgatcgtcaagagtgaccgggccagggcttctcatggggtcagctctctttctcctctcacacacacatacatgatacatatccctctcactcacgcacatactcaacaacaaaaataagtgctgatctattgcttcttgtaacagtcaaagacgaagattgcagaagtgatgacctctccagccatcactctaccatctgacaaaacagtaatgggtaatccatcgttgttttcgcccttattttttttggttattttccacttagctaccagttaagctaacaaggcatatgcaatgtctacagatgcggcagctctgatgctaaagaagaagatccacagattaccaattgtaaatcaggacagacaagtgataggtgagttttgagcagtggccaatacagaaaaaaaaagggctttcattttttccccttgattttataccatccttaacattgataattcagagtatgttgcatgctaaatggagttccaaacactattaacaggtatagttacccgtgctgacgttcttcgcgagttggaagccctgctggaggtttagacgtgcagtggtccatatgcttcggccttgttgtatatatgtaaatatatgccatggtgtttttgaatagcaggcatctctaatctgtaagagtgttgtagcgcgaatcaccaagataagcctgagaaaataaccggagagcttttctttgt</dnaseqindica> |
| External Link(s) |